BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30137.Seq (875 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11) 97 2e-20 SB_11248| Best HMM Match : LMP (HMM E-Value=0.18) 37 0.019 SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31) 35 0.075 SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) 31 1.6 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) 30 2.1 SB_43914| Best HMM Match : IRK (HMM E-Value=5.3) 30 2.8 SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) 29 4.9 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_17142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 >SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11) Length = 305 Score = 97.1 bits (231), Expect = 2e-20 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690 WVHRLRRQGK+L F+ LRDGTG+LQCVL +LC TY ALVL TE++V LYG ++AVPEGK Sbjct: 191 WVHRLRRQGKNLMFVVLRDGTGFLQCVLTDVLCHTYEALVLCTEATVCLYGVVKAVPEGK 250 Score = 66.9 bits (156), Expect = 2e-11 Identities = 32/83 (38%), Positives = 55/83 (66%) Frame = +2 Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436 SK + + ++ AK+QLKK K++ +E K+ ++ K E E ++R +NL++A+ I ++ D Sbjct: 106 SKAEGERFEKIAKAQLKKATKLYQQEKRKSEEREKKEAEKAQQREKNLEDARNITIKPDE 165 Query: 437 SLPKATVVKICETTEHRGQRICI 505 SLP A +KI +TT+ R QR+ I Sbjct: 166 SLPVAKQIKIRDTTDCREQRVKI 188 >SB_11248| Best HMM Match : LMP (HMM E-Value=0.18) Length = 442 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/109 (23%), Positives = 46/109 (42%) Frame = +2 Query: 185 ETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKA 364 +TI++N+E+ + +S C +D V+ S +Q I R+ + + + Sbjct: 41 KTIKENVETELQKVKEQLSDQACQLEDPVSS--VSRVSYFVTVQAIQTRDAERIAEITRL 98 Query: 365 EEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHRGQRICIRD 511 EEE EK + LDE K + L E +H+G + + D Sbjct: 99 EEE-LEKSQKGLDELNKQITDMTRELQDTQTRLEAEKQDHQGDKTQLED 146 >SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31) Length = 721 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +2 Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVVKICETTEH 484 KI+KI V ++K + K D + +KI + D + K + KIC T+ H Sbjct: 113 KIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICIWKICVTSNH 172 Query: 485 RGQRICI 505 + ++IC+ Sbjct: 173 KIRKICV 179 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Frame = +2 Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVV------KI 466 K +KI V ++K + K D + +KI + D + K V KI Sbjct: 91 KFRKICVTSDHKIRKICVTSDNKIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKI 150 Query: 467 CETTEHRGQRICIRDGYIVSGAKV 538 C T++H+ ++ICI + S K+ Sbjct: 151 CVTSDHKIRKICIWKICVTSNHKI 174 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +2 Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVVKICETTEH 484 KI+KI V ++K + K D + +KI + + + KIC T++H Sbjct: 124 KIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICIWKICVTSNHKIRKICVTSDH 183 Query: 485 RGQRICI 505 + ++ICI Sbjct: 184 KIRKICI 190 >SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 33.9 bits (74), Expect = 0.17 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 5/95 (5%) Frame = +2 Query: 266 DTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLP 445 DT Y + QLK +++ V+E +E+E EK + DE K+ Q + S P Sbjct: 300 DTPHYLKDKRIQLKGDEEVKVKELLAKAGTKGSEDEEDEKEQEKDDEGPKLQKQVETSKP 359 Query: 446 -----KATVVKICETTEHRGQRICIRDGYIVSGAK 535 TV K+ E E+ R G ++G K Sbjct: 360 GEEQEMVTVTKVVEEIEYTIHRDTKGLGINIAGGK 394 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/82 (21%), Positives = 39/82 (47%), Gaps = 4/82 (4%) Frame = +2 Query: 278 YDVAAKSQLKKIQKIWVRENYK----AMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLP 445 Y AK Q+ K K+ R + +MD+ EE +T + ++ + K+ + LP Sbjct: 1682 YGFTAKGQVAKDLKLGKRRRERRGEESMDEDSCEETDTNETRESTKKMKESMTASPDGLP 1741 Query: 446 KATVVKICETTEHRGQRICIRD 511 + K+C+ +R ++ +++ Sbjct: 1742 DSPKEKMCDGRNNRKKKESLKE 1763 >SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) Length = 1977 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 269 TKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKK 415 ++ Y QL+K+++ E+ + D+A+ T KR +NL+E KK Sbjct: 195 SEKYKSIQSEQLEKLKEQTRPESEELRDRARQLSRETNKRRKNLEEKKK 243 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 335 NYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436 NY +D++K +EN ++ AKKI ++E+P Sbjct: 282 NYTEVDESKPADENKNDKTDGAKTAKKINIKENP 315 >SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) Length = 443 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 293 KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPK 448 +SQ +++QKIW +A AE + +++Q+L E KKI ++ S P+ Sbjct: 368 RSQKRRVQKIW---RLRAGVLQAAEMKKKRQKAQSLAERKKIKKEKKKSNPR 416 >SB_43914| Best HMM Match : IRK (HMM E-Value=5.3) Length = 141 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 239 KWLFASMMHCFQYCLEWFLFRTITCIVI 156 KW + ++ C Y L W LF TI +++ Sbjct: 103 KWHWVILLFCVSYILSWVLFGTIWWLIV 130 >SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) Length = 228 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/69 (30%), Positives = 35/69 (50%) Frame = +2 Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436 S+D K+ ++A K K +K+ K ++K AEEE +K ++ D K ++ Sbjct: 85 SQDTKKEGEMAEKKAKAKERKL-----QKQLEKEAAEEEKVKKPKKSRDGEKTKKSKKVT 139 Query: 437 SLPKATVVK 463 S PK+ VK Sbjct: 140 SEPKSPKVK 148 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = +2 Query: 260 KDDTKDYDVAA---KSQLKKIQKIWVRENYKAMDKAKAEEENTEK 385 +DDTK+ D AA K++L++ + + VRE + + +A +E+ E+ Sbjct: 271 EDDTKEVDAAAAADKARLQRSKSLKVREGFSSAWEAIRVKESVER 315 >SB_17142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -2 Query: 832 HXGSLXAYGLIARQARLPH*GWR-RTTWWCESNQFPSNQLSAHDHPEPSFPR 680 H G L A L+ + + GW R+ W C+ +P N + + FPR Sbjct: 49 HQGFLAAVKLVHKSGYVSCAGWSYRSHWGCKGLAYPLNMFVTNAKNQVIFPR 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,233,163 Number of Sequences: 59808 Number of extensions: 575013 Number of successful extensions: 1562 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1545 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -