BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30136.Seq (884 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 1.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 5.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 5.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 5.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 5.6 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 24.2 bits (50), Expect = 1.4 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -1 Query: 374 DFSNKVRHYKLNLSINYLYWFVL 306 D K+RHY + + +N +W ++ Sbjct: 88 DNEPKLRHYLIFIFVNVFFWVII 110 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 268 DFHNTNSILVSVVH 227 DFHN IL+ +H Sbjct: 361 DFHNMGHILIGYIH 374 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 23 SPHTA---ALPPRTTRIHNPPTTPIRPN 97 +PH A LPP H PP P+ N Sbjct: 726 TPHEAFDVKLPPPPHPHHQPPRNPVGTN 753 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 23 SPHTA---ALPPRTTRIHNPPTTPIRPN 97 +PH A LPP H PP P+ N Sbjct: 618 TPHEAFDVKLPPPPHPHHQPPRNPVGTN 645 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/50 (24%), Positives = 19/50 (38%) Frame = +2 Query: 2 TPVTEQQSPHTAALPPRTTRIHNPPTTPIRPNNSTLTAMAVGDLFDCNRI 151 TP++ AA PP T P + ++ L A +DC + Sbjct: 20 TPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKRAAYDCEGV 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,509 Number of Sequences: 336 Number of extensions: 3594 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -