BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30136.Seq (884 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58340.1 68418.m07305 expressed protein ; expression supporte... 29 4.1 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 28 9.5 >At5g58340.1 68418.m07305 expressed protein ; expression supported by MPSS Length = 466 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 59 RIHNPPTTPIRPNNSTLTAMAVGDLFDCNRIKLTSL 166 R HNP +PI + ++A+ +GD DC ++K++S+ Sbjct: 15 RQHNPRASPI----NLISALKLGDSSDCIKLKISSV 46 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 5 PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94 P T PP +NPPTTP++P Sbjct: 167 PTTTPPVKPPTTTPPVQPPTYNPPTTPVKP 196 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,723,948 Number of Sequences: 28952 Number of extensions: 277239 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -