BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30134.Seq (882 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.60 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.60 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.60 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.60 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 0.60 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.60 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.60 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.2 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 4.2 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 4.2 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 5.5 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 5.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 9.7 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 160 MKRVHLGQSTVNANGETKRQRTSYTRYQT 188 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 3.2 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = -3 Query: 412 LSRHETASSSHRVANVXPVP---AASKAHTGPAGGATHRPAHSGGGT 281 L H A + R VP + GPA H PAH GT Sbjct: 303 LHDHRPALAQQRRVAAVQVPQLAGGGRRGPGPARSRRHLPAHLVAGT 349 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 813 NSGHGHMEWXIIVNNSPNKHXS 748 NSG G ++ NNSP+++ S Sbjct: 165 NSGEGSLQENRYYNNSPDQYQS 186 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 4.2 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +2 Query: 488 CHFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFNQYIFAHVASFVIIWM 667 CH +G F++P N+T L+ + +G +V+ ILG F +Y+ V + + Sbjct: 109 CHTFGR-FLAP-NLTY-----LLVALYSG---YVWTDILGFGYFREYLAEAVQLYFQFYY 158 Query: 668 TILICL 685 T +C+ Sbjct: 159 TYFLCV 164 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 150 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 245 SDC Q+ H+NE+ R + + YES Sbjct: 27 SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 150 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 245 SDC Q+ H+NE+ R + + YES Sbjct: 27 SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 159 MDKSRLRQSTVHSNEIGERQRSQ 227 M + L QSTV++N +RQR++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTR 226 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,410 Number of Sequences: 336 Number of extensions: 4817 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -