BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30132.Seq (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.2 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.6 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 404 ASALDAFK*STRITKLKLTSRPSIVTVPSAIFATRSIVQHP 526 A+ +D K +TR T + P+ +VPSA R+ Q P Sbjct: 966 AALIDELKPATRYTIRVIAEGPAGRSVPSAELIVRTEPQRP 1006 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 404 ASALDAFK*STRITKLKLTSRPSIVTVPSAIFATRSIVQHP 526 A+ +D K +TR T + P+ +VPSA R+ Q P Sbjct: 962 AALIDELKPATRYTIRVIAEGPAGRSVPSAELIVRTEPQRP 1002 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -1 Query: 311 WAQFVWTDGHSPLNRSSTCA*SIHCRIRARRTSSPPTELF 192 W +WTD H N S + R+ R P T L+ Sbjct: 57 WVTQIWTDHHLKWNASEFAGIRV-IRVPYNRVWRPDTILY 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,604 Number of Sequences: 438 Number of extensions: 4140 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -