BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30125.Seq (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 26 0.96 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.96 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 24 3.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.9 U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles ... 24 5.1 EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426174-1|ABO26417.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426169-1|ABO26412.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426167-1|ABO26410.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426166-1|ABO26409.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426165-1|ABO26408.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426164-1|ABO26407.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426162-1|ABO26405.1| 155|Anopheles gambiae unknown protein. 24 5.1 EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. 24 5.1 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 5.1 EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. 23 6.7 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 6.7 EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 23 8.9 EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 23 8.9 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 8.9 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 8.9 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 26.2 bits (55), Expect = 0.96 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 479 GNGISEGMGGQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDD 625 G G S+G+ G + N +V + P E P + D P+ T+ L D Sbjct: 2067 GGGKSKGIIGSTQANIGIVDSNISPKESPDSIGD--PQGRQTAVLVESD 2113 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.96 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 442 SGAVTENVASPLVASLPPKTAYGPPGP 362 +G V E SP V +PP++ PP P Sbjct: 1094 TGEVEEEEVSPPVPPIPPRSRRLPPSP 1120 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 24.2 bits (50), Expect = 3.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 479 GNGISEGMGGQFRENYDLVGRLLRPGE-EPRNYSDEE 586 GNGI G +F E YD + + L E +P ++ +E Sbjct: 44 GNGIFSQKGTKFDERYDKLAKDLYKSELKPLDFVGDE 80 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 518 ENYDLVGRLLRPGEEPRNYSDEEPEEADTSAL 613 +N DL + L+P PR + EP AD +++ Sbjct: 150 DNEDLCNQDLQPPYSPRTTTTPEPPLADPNSM 181 >U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles gambiae putativetrypsin-like enzyme precursor, mRNA, partial cds. ). Length = 62 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 44 PRIKWIHHQRLKMCK-PNTVAFLRP 115 P ++WIH R+++ P T A RP Sbjct: 37 PPVRWIHRYRVRISDVPPTPALPRP 61 >EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426174-1|ABO26417.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426169-1|ABO26412.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426167-1|ABO26410.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426166-1|ABO26409.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426165-1|ABO26408.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426164-1|ABO26407.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426162-1|ABO26405.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 358 STVPVGHMLFLEEEM 402 ST PV H+L LEEE+ Sbjct: 177 STEPVEHVLHLEEEL 191 >EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 373 GHMLFLEEEMPQEDSPRSLSQHLKRTM 453 GH LFL E Q+ P +S + K T+ Sbjct: 60 GHSLFLPAESRQQLEPACVSVYAKGTV 86 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 291 QEGGRVLMAVNG-WIFDVTRGNRFYG 365 +EG RVL+AVNG W + YG Sbjct: 91 EEGDRVLIAVNGIWAERAVEMSERYG 116 >EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 420 WRVLLWHLFLQKQHM 376 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +2 Query: 338 CD*RESVLRSRWAICCFWRKRCHKRTR 418 C +++ +R C W K+C +RT+ Sbjct: 72 CFCKKNYVRRAIGGSCIWAKKCPRRTQ 98 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 361 TVPVGHMLFLEEEM 402 +VPV H+L LEEE+ Sbjct: 159 SVPVEHVLHLEEEL 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,936 Number of Sequences: 2352 Number of extensions: 14760 Number of successful extensions: 96 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -