BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30124.Seq (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase pr... 24 5.0 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 23 6.6 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 23 6.6 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 23 6.6 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 23 6.6 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 23 8.7 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 23 8.7 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 23 8.7 >Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase protein. Length = 237 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -3 Query: 565 MLLEVIGIRCPLSLANPRLILTHGHSLSWGIPKQCKARRY 446 MLL C SL N R I+T H + P+Q A+ Y Sbjct: 17 MLLYRGAFYCGGSLINDRYIVTAAHCVLSFTPQQLLAKLY 56 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199 +R + H E A E+F C+ E GNL Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199 +R + H E A E+F C+ E GNL Sbjct: 119 DRPAPHDEACERAYESFRCYYEHYGNL 145 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199 +R + H E A E+F C+ E GNL Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 323 IRIRGINQVSPKSVKFCNC 379 + + IN+ S + +FCNC Sbjct: 564 VALSNINEPSTEQFRFCNC 582 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 526 LANPRLILTHGHSLSWGIPK 467 L P I +GHS+S IPK Sbjct: 84 LPGPMTIHNNGHSVSLSIPK 103 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 128 SSH*EITGYAKEAFFCHQEEEGNL 199 S H ++ A E+F C+ E+ GN+ Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 128 SSH*EITGYAKEAFFCHQEEEGNL 199 S H ++ A E+F C+ E+ GN+ Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,261 Number of Sequences: 2352 Number of extensions: 13005 Number of successful extensions: 64 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -