BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30122.Seq (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 25 0.86 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 3.5 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 3.5 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 3.5 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 3.5 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 4.6 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 4.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.6 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 4.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 6.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 6.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 6.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 8.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 8.0 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 8.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 8.0 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.0 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 24.6 bits (51), Expect = 0.86 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 589 VYGSL-FSTMLLEVIGIRCPLSLAN 518 V+GS+ + ++E+IGI C L LAN Sbjct: 196 VFGSVAIAIAIVELIGIICALCLAN 220 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 136 LGDYRLR*RGVLLPSRRRGKSS 201 + DY++ + +LLP R GKS+ Sbjct: 128 VADYKIEGKVLLLPVRGAGKSN 149 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 579 ASSQQCCWK*LVYVVHSAWRI 517 A++ CW + Y+V AW I Sbjct: 65 AAAVMSCWMNVYYIVILAWAI 85 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 326 RIRGINQVSPKSVKFCNCLDC 388 + GI+ +P C+CLDC Sbjct: 312 KYEGISS-TPSQASSCSCLDC 331 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 445 RIAEPYIAWGYPNLKSVRELVS 510 R+ +PY W + N K +VS Sbjct: 106 RLLQPYPDWSWANYKDCSGIVS 127 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 541 RCPLSLANPRLILTHG 494 RC L L PR+IL+ G Sbjct: 625 RCNLGLEPPRVILSSG 640 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 541 RCPLSLANPRLILTHG 494 RC L L PR+IL+ G Sbjct: 625 RCNLGLEPPRVILSSG 640 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 541 RCPLSLANPRLILTHG 494 RC L L PR+IL+ G Sbjct: 625 RCNLGLEPPRVILSSG 640 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/47 (25%), Positives = 19/47 (40%) Frame = +1 Query: 322 HPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPY 462 H W Q F ++ + + N G+ RL T + RI + Y Sbjct: 2 HHRMWLQQIFILLQMIHLIAWASLENTGISDRLENVTQTISRILDGY 48 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245 + RS + + RE K+ QY K + KE+ Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 445 RIAEPYIAWGYPNLKSVRELVS 510 R+ +PY W + K ++VS Sbjct: 103 RLLKPYPDWSFAEFKDCSKIVS 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,271 Number of Sequences: 438 Number of extensions: 3651 Number of successful extensions: 36 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -