BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30120.Seq (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom... 27 2.0 SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 27 2.0 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 25 6.0 SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce... 25 7.9 SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual 25 7.9 SPAC57A10.12c |ura3||dihydroorotate dehydrogenase Ura3|Schizosac... 25 7.9 SPAC19A8.12 |dcp2||mRNA decapping complex subunit Dcp2|Schizosac... 25 7.9 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 7.9 >SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 27.1 bits (57), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 485 GIPVIRPLMMESTALGAAIVAGRAMRVW 402 GIP+I P+ L A+ + RA ++W Sbjct: 131 GIPIIDPVTRAPAVLAGAVSSSRAKQMW 158 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 27.1 bits (57), Expect = 2.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 290 WTDTKNEHVNAENQIELLQFCRRDFFSSEPPY 195 W +T+N + N +E+L R+ S P Y Sbjct: 764 WANTENARYSTSNALEILDMLLREKIESAPRY 795 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 25.4 bits (53), Expect = 6.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 553 RQLLADGGMAQNSVLCRCRLIYWVYQSFVPS*WK 452 +++ +D +Q +V R L+ W++ S PS WK Sbjct: 162 QRIFSDLQFSQKTVDYRLSLLRWIHLSSWPSNWK 195 >SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1242 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 363 QECIGRWAGYCRGPHTHCATC 425 QEC+ W G+ + THC C Sbjct: 36 QECLVEWLGHSK--KTHCELC 54 >SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 366 Score = 25.0 bits (52), Expect = 7.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 379 GGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACI-CTELSSAPSL 534 GGLG V T I + P S + ++TG S++A T L++ P + Sbjct: 52 GGLGFDVARTGIGTVGFIGFPSVGKSTLMTQLTGTRSEAAAYEFTTLTTVPGV 104 >SPAC57A10.12c |ura3||dihydroorotate dehydrogenase Ura3|Schizosaccharomyces pombe|chr 1|||Manual Length = 443 Score = 25.0 bits (52), Expect = 7.9 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +1 Query: 388 GIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICT 510 G++VG+T + RP T+ + V G ++G P K + T Sbjct: 330 GVIVGNTTVQRPKTLKSTSHVEE--TGGLSGPPLKPIALNT 368 >SPAC19A8.12 |dcp2||mRNA decapping complex subunit Dcp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 741 Score = 25.0 bits (52), Expect = 7.9 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 288 PSHAFIQGFFPTNSPHFSFF-IGKSRQECIGRWAGYCRGPHT 410 PS + Q F+P S S + +GK+ Q G + Y G T Sbjct: 410 PSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQT 451 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 386 WVLSWATHALRDLRQWPPPGLYF 454 W L+ A D+R WPP ++F Sbjct: 403 WTLTDLADAFLDVRLWPPIFMFF 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,274,979 Number of Sequences: 5004 Number of extensions: 48077 Number of successful extensions: 111 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -