BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30120.Seq (576 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl... 48 3e-06 At4g30310.3 68417.m04309 ribitol kinase, putative similar to rib... 35 0.045 At4g30310.2 68417.m04308 ribitol kinase, putative similar to rib... 35 0.045 At4g24900.1 68417.m03564 expressed protein 30 1.3 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 2.9 At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa... 28 3.9 At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein ... 28 3.9 At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 28 3.9 At5g24480.1 68418.m02885 hypothetical protein similar to unknown... 28 5.1 At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal... 28 5.1 At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5... 27 6.8 >At1g80460.1 68414.m09423 glycerol kinase, putative similar to glycerol kinase (ATP:glycerol 3-phosphotransferase, Glycerokinase, GK)[Mycobacterium tuberculosis] Swiss-Prot:O69664 Length = 522 Score = 48.4 bits (110), Expect = 3e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -2 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402 +Q+QADL+G PV+RP+ +E+TALGAA AG A+ W Sbjct: 438 MQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFW 473 >At4g30310.3 68417.m04309 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 451 Score = 34.7 bits (76), Expect = 0.045 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -2 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 361 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 398 >At4g30310.2 68417.m04308 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 579 Score = 34.7 bits (76), Expect = 0.045 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -2 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526 >At4g24900.1 68417.m03564 expressed protein Length = 421 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -1 Query: 510 CADAG*FTGYTSHSSPHDGK-YSPGGGHCRRSRNACVAHDNTQPTGRYIPAG 358 C ++G G+ HS P K YS G +C + N V+ D Q G Y P G Sbjct: 224 CDESG--NGFGEHSIPCRSKDYSGNGNYCTQE-NYQVSQDKKQIDGSYNPPG 272 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 2.9 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = -3 Query: 388 PAHRPIHSCRLLPMKNEKCGEFVGKKP*INAWDGPILK--MNMST---QKIR*NYCSFAA 224 P P+ S RL PM + CG K+ + W G + K ++ ST Q++ + C + Sbjct: 899 PPFSPLLSPRLPPMVTQLCGSEASKQNIGHQWQGALSKSGVHYSTIIAQRLESDICKYII 958 Query: 223 GTFFPRNRP 197 G+ P P Sbjct: 959 GSPEPVQWP 967 >At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 3.9 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 498 G*FTGYTSH-SSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSY 352 G FT Y H + DG +P GG RR NA VA T P Y Sbjct: 60 GFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVY 109 >At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 397 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -1 Query: 486 GYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSYQ 349 GY S+ D Y GHC+ H QPT +P Q Sbjct: 127 GYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 552 GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSP 442 G+ + +RT++ DAG F G SHS+ SP Sbjct: 128 GSEDQSSPQKRTRYSPDAGDFKGVESHSNTQGSPDSP 164 >At5g24480.1 68418.m02885 hypothetical protein similar to unknown protein (gb|AAD32930.1) Length = 350 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 470 RPLMMESTALGAAIVAGRAMRVWPTTIPSP---PADTFL 363 RP ++ + R R WP T+PSP A TFL Sbjct: 10 RPHFQSIHFFDCSLTSDRGQRSWPATLPSPQPLSASTFL 48 >At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal, putative / glycolate oxidase, putative / short chain alpha-hydroxy acid oxidase, putative similar to Chain A, Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24 Replaced By Phe (Y24f) gi|999542 Length = 363 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTAL 441 R R ++S++ M +LG P+ P+M+ TA+ Sbjct: 49 RPRVLVDVSNIDMSTSMLGYPISAPIMIAPTAM 81 >At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) / salicylic acid induction deficient 1 (SID1) identical to SP|Q945F0; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 543 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 442 WGRPLSQVAQCVCGPRQYPAHRPIHSCRLL 353 WG PLSQ AQ Y A+R + R L Sbjct: 371 WGEPLSQTAQSFMPEMLYGANRNLPKARTL 400 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,066,607 Number of Sequences: 28952 Number of extensions: 264614 Number of successful extensions: 581 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -