BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30115.Seq (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 23 2.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.1 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 5.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 470 YRPIHRDDTFMVRGACAPSSSKWSKQIHHHFASWLLIP 583 +R + +DDT MVR A A + ++ + + LIP Sbjct: 172 FRALCQDDTPMVRRAAATKLGELAQVVELEYLKTDLIP 209 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 508 RGMRAVEFKVVETDPSPFCIVAPD 579 RG + +KV E PSP V+P+ Sbjct: 102 RGPKRKTWKVEEDSPSPTSSVSPE 125 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 114 WVCPCDGGSRSINHQGFYYLPFYS 43 W+C + S + FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 417 VLLAIYSKYT*SRTSWRLTVRSIVTTPSWSA 509 +LL IYS + + SW ++V P +A Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKPDPNA 1047 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 417 VLLAIYSKYT*SRTSWRLTVRSIVTTPSWSA 509 +LL IYS + + SW ++V P +A Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKPDPNA 1047 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,663 Number of Sequences: 336 Number of extensions: 3740 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -