BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30115.Seq (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45627| Best HMM Match : AAA (HMM E-Value=0) 120 1e-27 SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_53844| Best HMM Match : SRCR (HMM E-Value=0) 28 8.2 SB_35950| Best HMM Match : SRCR (HMM E-Value=0) 28 8.2 SB_9672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 120 bits (289), Expect = 1e-27 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681 GMRAVEFKV+ETDPSP+CIVAPDTVIHC+GEP+KREEEEE+LN VGYDDIGGCRKQL Sbjct: 111 GMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEVGYDDIGGCRKQL 167 Score = 106 bits (254), Expect = 2e-23 Identities = 48/61 (78%), Positives = 58/61 (95%) Frame = +3 Query: 72 DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVC 251 D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TVC Sbjct: 5 DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTVC 64 Query: 252 I 254 I Sbjct: 65 I 65 >SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1266 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +1 Query: 88 RSSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNFNSSVVTQSCSRANAARKP 246 RSSV R T ++ K S +T ++W +WSN++ + S SR ++ R P Sbjct: 364 RSSV-REQATATVMSKGSYITIRNW----TRWSNYSGGGYSISNSRPSSRRNP 411 >SB_53844| Best HMM Match : SRCR (HMM E-Value=0) Length = 415 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -1 Query: 570 HDAKW*WICFDHFELDGAHAPRTMKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 394 H W IC+DH++L AH V+ R +G A +K K T + LP V S +G Sbjct: 255 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 307 Query: 393 S 391 + Sbjct: 308 N 308 >SB_35950| Best HMM Match : SRCR (HMM E-Value=0) Length = 501 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -1 Query: 570 HDAKW*WICFDHFELDGAHAPRTMKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 394 H W IC+DH++L AH V+ R +G A +K K T + LP V S +G Sbjct: 318 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 370 Query: 393 S 391 + Sbjct: 371 N 371 >SB_9672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 526 EFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDD-IGGCRKQ 678 +++ + P PFCI+ VI G P+ R + + + N Y IG KQ Sbjct: 117 QYREPQRPPPPFCILNVKKVIKHSGSPVYR-DPDSSQNRYQYSTLIGNSSKQ 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,199,825 Number of Sequences: 59808 Number of extensions: 474672 Number of successful extensions: 1188 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -