BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30114.Seq (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 1.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.0 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 22 4.6 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 4.6 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 22 4.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.1 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -1 Query: 423 SRGASLLLQPTDDVISLTTT*IVDRTXIPEEFESRVSSYTVALGEILFLSC 271 ++G L P + LTT ++ + IP+E S YT + +I C Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 203 VPEICSGRTMEHRIQLKCTPWL*LQFQS 120 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 203 VPEICSGRTMEHRIQLKCTPWL*LQFQS 120 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 277 ELRQLSLVDRRFFFSQLCCCLGVFRC 200 E ++L D+R+ QL C LG C Sbjct: 36 EQLNMALSDQRYLRRQLKCALGEAPC 61 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 453 RTYRCQYCYCIWFLFG 500 R +C Y YC+W FG Sbjct: 67 RQLKC-YMYCLWEQFG 81 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 277 ELRQLSLVDRRFFFSQLCCCLGVFRC 200 E ++L D+R+ QL C LG C Sbjct: 36 EQLNMALSDQRYLRRQLKCALGEAPC 61 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.1 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 444 TG*RTYRCQYC 476 TG + Y+C+YC Sbjct: 115 TGEKPYQCEYC 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,356 Number of Sequences: 438 Number of extensions: 2960 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -