BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30112.Seq (446 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. 27 0.40 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 3.7 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 6.5 >EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 26.6 bits (56), Expect = 0.40 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 213 GIECCYGVSVXETRVGSTAENVSRKATAVN--L*YMKKLQTVPK 338 G +C YG+ V + G+T+ N+ R V+ + Y+K+ Q +P+ Sbjct: 21 GAKCLYGLKVFKYNKGTTS-NLKRHLNLVHKTVPYLKQKQPIPQ 63 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 3.7 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 377 ITVYCYTKIQQSFLRDSLKLLHISKI--DCSSLSRNILRRASDSGL 246 I+ Y T + D L +S + C SLSRN+ + +S S L Sbjct: 836 ISEYPRTLVANDSTNDLLSHNKVSSLHGSCDSLSRNVSQASSTSDL 881 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 144 YTNHLPCGTDPLVQWNLFH 88 Y P G D +V+W FH Sbjct: 386 YWQDRPLGNDIMVEWLTFH 404 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,388 Number of Sequences: 2352 Number of extensions: 9051 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -