BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30112.Seq (446 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67100.1 68418.m08460 DNA-directed DNA polymerase alpha catal... 28 2.5 At4g11900.1 68417.m01893 S-locus lectin protein kinase family pr... 28 2.5 At5g47180.2 68418.m05818 vesicle-associated membrane family prot... 28 3.3 At5g47180.1 68418.m05817 vesicle-associated membrane family prot... 28 3.3 At1g17590.3 68414.m02169 CCAAT-binding transcription factor (CBF... 28 3.3 At1g17590.2 68414.m02168 CCAAT-binding transcription factor (CBF... 28 3.3 At1g17590.1 68414.m02167 CCAAT-binding transcription factor (CBF... 28 3.3 At3g06180.1 68416.m00710 expressed protein 27 4.4 At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:... 27 4.4 At5g53920.1 68418.m06709 ribosomal protein L11 methyltransferase... 27 7.6 At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-conta... 27 7.6 At5g05110.1 68418.m00542 cysteine protease inhibitor, putative /... 27 7.6 >At5g67100.1 68418.m08460 DNA-directed DNA polymerase alpha catalytic subunit, putative similar to SP|O48653 DNA polymerase alpha catalytic subunit (EC 2.7.7.7) {Oryza sativa}; contains Pfam profiles: PF03175 DNA polymerase type B, organellar and viral, PF00136 DNA polymerase family B, PF03104 DNA polymerase family B, exonuclease domain Length = 1492 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = -1 Query: 335 RDSLKLLHISKIDCSSLSRNILR-RASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWT 159 ++ +L I + + L+R L DS + GH+++ FD LL R ++ W+ Sbjct: 637 KNGCNVLSIENSERALLNRLFLELNKLDSDILVGHNISGFDLDVLLQRAQACKVQSSMWS 696 Query: 158 VLSHSTQTTFP 126 + ++ P Sbjct: 697 KIGRLKRSFMP 707 >At4g11900.1 68417.m01893 S-locus lectin protein kinase family protein contains Pfam domains, PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain, and PF01453: Lectin (probable mannose binding) Length = 849 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 221 FDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAARILLFNGIY 93 FDS L+LR +S + + W H + T P +I L + ++ Sbjct: 160 FDSGNLVLRDGPNSSAAVLWQSFDHPSDTWLPGGKIRLGSQLF 202 >At5g47180.2 68418.m05818 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia], to VAMP-associated protein B GI:4240464 [Rattus norvegicus] and to Vesicle-associated membrane protein/synaptobrevin binding protein (VAP-33) (SP:Q16943)[Aplysia californica] Length = 220 Score = 27.9 bits (59), Expect = 3.3 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = -1 Query: 350 QQSFLRDSLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSD 171 Q +F +DS K L K+ S ++ + +R+S+SG G ++ +++ + R + + Sbjct: 108 QDTFTKDSGKTLTECKLKVSYITPSTTQRSSESGATNGDGQSS-ETISTIQRLKEERDAA 166 Query: 170 IRWT-VLSHSTQT 135 ++ T L H +T Sbjct: 167 VKQTQQLQHELET 179 >At5g47180.1 68418.m05817 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia], to VAMP-associated protein B GI:4240464 [Rattus norvegicus] and to Vesicle-associated membrane protein/synaptobrevin binding protein (VAP-33) (SP:Q16943)[Aplysia californica] Length = 220 Score = 27.9 bits (59), Expect = 3.3 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = -1 Query: 350 QQSFLRDSLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSD 171 Q +F +DS K L K+ S ++ + +R+S+SG G ++ +++ + R + + Sbjct: 108 QDTFTKDSGKTLTECKLKVSYITPSTTQRSSESGATNGDGQSS-ETISTIQRLKEERDAA 166 Query: 170 IRWT-VLSHSTQT 135 ++ T L H +T Sbjct: 167 VKQTQQLQHELET 179 >At1g17590.3 68414.m02169 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 328 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 323 KLLHISKIDCSSLSRNILRRASDSGLXYGHS 231 +L + + DCS+ SR+ + ASDS +GHS Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291 >At1g17590.2 68414.m02168 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 328 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 323 KLLHISKIDCSSLSRNILRRASDSGLXYGHS 231 +L + + DCS+ SR+ + ASDS +GHS Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291 >At1g17590.1 68414.m02167 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 328 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 323 KLLHISKIDCSSLSRNILRRASDSGLXYGHS 231 +L + + DCS+ SR+ + ASDS +GHS Sbjct: 261 QLQNSNDCDCSTTSRSDITSASDSVNLFGHS 291 >At3g06180.1 68416.m00710 expressed protein Length = 241 Score = 27.5 bits (58), Expect = 4.4 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -2 Query: 181 LALISDGQSSATVHKPPSLRHGSSCSMESISQKSSS 74 L L+SD + S T PPS S S S S SSS Sbjct: 4 LLLLSDEEHSTTNSMPPSSSASRSASNHSSSSSSSS 39 >At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note: CHX6a and CHX6b were originally 1 gene but were split pased on alignments with other family members; may be a pseudogene and requires futher investigation; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 818 Score = 27.5 bits (58), Expect = 4.4 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 8/80 (10%) Frame = -1 Query: 296 CSSLSRNILRRASDSGLX--------YGHSVTAFDSVFLLLRTESSSGSDIRWTVLSHST 141 C SL+ R DS + + S++AF S+ LL+ S+ LS + Sbjct: 169 CGSLTFRYRERRGDSSILRMEYRLIIFLQSISAFTSIDTLLKDLQIKHSEFGRIALSGAM 228 Query: 140 QTTFPAARILLFNGIYFTEI 81 T A + FN IY+ ++ Sbjct: 229 VTDMLAFGVTFFNAIYYEKL 248 >At5g53920.1 68418.m06709 ribosomal protein L11 methyltransferase-related similar to ribosomal protein L11 methyltransferase; PrmA [Escherichia coli] GI:455655 Length = 371 Score = 26.6 bits (56), Expect = 7.6 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -1 Query: 311 ISKIDCSSLSRNILRRASDSGLXYGHSVT--AFDSVFLLLRTESSSGS 174 I C +LSR+ILR + L + S T + S+F L T SSS S Sbjct: 7 IKHFPCKNLSRHILRDSRVRPLCFFTSSTPPSSFSIFASLSTSSSSSS 54 >At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 884 Score = 26.6 bits (56), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 365 CYTKIQQSFLRDSLKLLHISKIDCSSLSRNILR 267 CY KIQQ R K L I++++ SL N+++ Sbjct: 694 CYAKIQQIVWRPVFK-LQINRLEPKSLLENVIQ 725 >At5g05110.1 68418.m00542 cysteine protease inhibitor, putative / cystatin, putative similar to cysteine proteinase inhibitor [Glycine max] GI:1944342; contains Pfam profile PF00031: Cystatin domain Length = 232 Score = 26.6 bits (56), Expect = 7.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -2 Query: 133 PSLRHGSSCSMESISQKSSSLFP 65 P ++ + +M+S+ QKS+SLFP Sbjct: 162 PEVQEAAKHAMKSLQQKSNSLFP 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,672,143 Number of Sequences: 28952 Number of extensions: 177350 Number of successful extensions: 552 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -