BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30110.Seq (444 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) 41 4e-04 SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06) 27 9.2 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 58.8 bits (136), Expect = 2e-09 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +2 Query: 8 FFWYTKLKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR 151 FF M K ++KG+SAINEVVTREYT+NLHKR+HG+ R Sbjct: 759 FFLLLDFSFKMVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYR 806 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +1 Query: 262 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 405 NVP+ N+DEDS HKL+TLVT V V++ KGLQT+ V++ + Sbjct: 802 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVESEE 849 >SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) Length = 776 Score = 41.1 bits (92), Expect = 4e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +1 Query: 262 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 387 NVP+ N+DEDS HKL+TLVT V V++ K L E Sbjct: 2 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKVLADE 43 >SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 62 KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRK 181 K K INEV+T Y + L KR R IKE+ + Sbjct: 213 KNKPEINEVITPRYPPGEGEVLDDASIIKRYKRQIKELEE 252 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 26.6 bits (56), Expect = 9.2 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +2 Query: 26 LKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGV-GFKKRAPRAIKEIRKFAE--KQ 196 + + + K K R+ NE + REY LHK L + F PR R + KQ Sbjct: 91 IALVIEKDKSLRRKIEEENEQLKREYLQQLHKTLEALRTFDFNNPRDAIFKRNLVKMHKQ 150 Query: 197 MGTPDIRVDTRLN 235 +G +RV +N Sbjct: 151 VGNYCLRVYGEMN 163 >SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06) Length = 438 Score = 26.6 bits (56), Expect = 9.2 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = -1 Query: 243 RNLFKRVSTRMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLP 64 RNL KRV R P C + R + + L R CK +V S +T+ + Sbjct: 214 RNLAKRVHERFGDAPGCEFRHRRRNSGVGTSEILTDCSGERSCKRSVTSNRSTNSSSKER 273 Query: 63 FLSPLGLAI 37 ++ PL I Sbjct: 274 WMGPLASCI 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,730,714 Number of Sequences: 59808 Number of extensions: 244401 Number of successful extensions: 448 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -