BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30109.Seq (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 28 0.22 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 28 0.22 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 2.8 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 8.4 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 8.4 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 28.3 bits (60), Expect = 0.22 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 217 GRHCGFGKRRGTAMRVCHRRNY 282 G+HCG+ + G ++V H R++ Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 28.3 bits (60), Expect = 0.22 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 217 GRHCGFGKRRGTAMRVCHRRNY 282 G+HCG+ + G ++V H R++ Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 49 CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 162 CG K++ +DP E+ +R+M K+ ++ K+P Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 176 PAPVSAKTQRHVERVVTVAL 235 P P+ KT H+E++ + L Sbjct: 59 PNPLEQKTNAHIEKIFLITL 78 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 100 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 192 N ++ +R IK+GL + +PVA + RA R Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,070 Number of Sequences: 2352 Number of extensions: 12954 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -