BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30108.Seq (591 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1772 + 29411874-29413218,29413355-29413421,29413749-294138... 30 1.6 01_06_1742 - 39585879-39585994,39586089-39586238,39586288-395863... 28 6.4 06_01_0313 - 2250312-2250516,2250585-2250610,2250792-2251076,225... 27 8.5 03_05_0769 - 27579251-27579934 27 8.5 >07_03_1772 + 29411874-29413218,29413355-29413421,29413749-29413896, 29415293-29415416,29416340-29416590,29416923-29418449, 29418786-29418896,29419576-29419734,29419827-29421734 Length = 1879 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 343 QKQVAICNYVCN*VVFLSIDNIGKHS*LHITQTIKTSSSSACISPLLDVNLSH 501 +K V N+ VV +D + +H+ + TQ + SSS+ SPLL + +++ Sbjct: 500 EKPVTTRNHAYAEVVVFVLDQMTRHTQVTSTQRKQARSSSSSASPLLSLRITY 552 >01_06_1742 - 39585879-39585994,39586089-39586238,39586288-39586375, 39586479-39586640,39586753-39586877,39586992-39587030, 39587290-39587476,39587643-39587713,39589371-39589564, 39589656-39589767,39589899-39590082,39590177-39590503, 39590780-39591061,39591148-39591621,39591730-39591813, 39591850-39591939,39592024-39592247,39592503-39592600, 39592679-39593169,39593249-39593520,39594266-39594522, 39594672-39594890,39595007-39595167,39595249-39595441, 39595528-39595633,39595947-39596121,39596404-39596556, 39596663-39596794,39597120-39597184,39597754-39597819, 39598433-39598511,39598587-39598767,39598864-39598976 Length = 1889 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 475 PLLDVNLSHSPHNARSSTFR 534 PLL + SH+PHN SS FR Sbjct: 899 PLLVLKPSHNPHNLLSSKFR 918 >06_01_0313 - 2250312-2250516,2250585-2250610,2250792-2251076, 2251289-2251567,2251817-2252121,2252581-2252860, 2253209-2253475 Length = 548 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 112 DEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALL 210 DE+ PP S +D + +E G + +C++ +L+ Sbjct: 180 DEEGPPDSSQDILKFLENGLSRTYNDCFVESLI 212 >03_05_0769 - 27579251-27579934 Length = 227 Score = 27.5 bits (58), Expect = 8.5 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 52 TLMGVFYYIRAVALLEDLPFDEKNPPHSIEDF-VIEVEKGYTLNAQNC 192 TL GV + V LL+ P N P ++DF V +++ TLN C Sbjct: 7 TLAGV---VLVVLLLQQAPVLRANDPDPLQDFCVADLDSEVTLNGYPC 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,767,527 Number of Sequences: 37544 Number of extensions: 305116 Number of successful extensions: 752 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -