BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30108.Seq (591 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_53659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +2 Query: 431 LLKLLKHRHRQPVSLHCWM*TSPIVRTMH--DPLPFASN 541 ++ + H+H Q S+HC + T+ +R H +P F SN Sbjct: 765 IMSEMAHKHFQQASIHCLLYTNFQIRPKHNMEPEKFESN 803 >SB_53659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 11/50 (22%) Frame = -2 Query: 581 NKWADDLWQYAGK------NWM-----RKVEDRALCGLWERFTSSSGEIQ 465 ++WADDLW A K WM RK E+R+ G R T S ++Q Sbjct: 133 DRWADDLWTDAQKVGGKVNRWMDSQTDRKWEERSTDGWTVRRTESGRKVQ 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,487,448 Number of Sequences: 59808 Number of extensions: 358467 Number of successful extensions: 842 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -