BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30108.Seq (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 31 0.43 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 31 0.43 At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta... 28 5.4 At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR... 27 7.1 At5g46510.1 68418.m05727 disease resistance protein (TIR-NBS-LRR... 27 7.1 At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative si... 27 9.4 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 31.5 bits (68), Expect = 0.43 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 31 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 165 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1148 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1192 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 31.5 bits (68), Expect = 0.43 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 31 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 165 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1147 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1191 >At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains BTB/POZ domain, INTERPRO:IPR000210 Length = 517 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 427 HITQTIKTSSSSACISPLLDVNLSHSP 507 H + ++ +SSSS +SP +NLS SP Sbjct: 22 HHSSSLSSSSSSLSLSPKQPINLSSSP 48 >At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1298 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +1 Query: 79 RAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSGHQFWLKI 258 RA + F E +PP E+ V+E+ A + + ++ L ++W+K+ Sbjct: 390 RAQEMFCQSAFGENSPPEGFEELVVEI----AWLAGSLPLGLTVFGSALRGRKKEYWVKM 445 Query: 259 VPQLVCNIEG 288 +P+L +++G Sbjct: 446 LPRLQNDLDG 455 >At5g46510.1 68418.m05727 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1353 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +1 Query: 79 RAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSGHQFWLKI 258 RA + F E +PP E+ V+E+ A + + ++ L ++W+K+ Sbjct: 351 RAQEMFCQSAFGENSPPEGFEELVVEI----AWLAGSLPLGLTVFGSALRGRKKEYWVKM 406 Query: 259 VPQLVCNIEG 288 +P+L +++G Sbjct: 407 LPRLQNDLDG 416 >At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase, Zea mays, PIR2:JQ1329; contains non-consensus (GC) donor splice site at intron 4 Length = 1050 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 86 SLCWRIYHLMRKIRLIL 136 ++CWRI+HL RK + I+ Sbjct: 102 NICWRIWHLARKKKQIV 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,064,314 Number of Sequences: 28952 Number of extensions: 258670 Number of successful extensions: 657 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -