BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30107.Seq (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 29 0.031 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 8.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.3 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 29.5 bits (63), Expect = 0.031 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 2/125 (1%) Frame = +2 Query: 209 EGAQKEDQRSRKREQ--SKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHA 382 + A+ ++R R+ E + P P TV R K++Q ++ +++E NRR H Sbjct: 8 QAAEYIERREREAEHGYASTMPMPDDMRTVTKRPKTKKSQGSRTTHNELEKNRRA---HL 64 Query: 383 RSIVMLSVRLRVVVKIGRRTVPQKXGRSSAGHRDASLAIVGLLQRAPQF*RQQPGRCRAF 562 R+ + +L+V+V +G T R +L GLL +A +F + R R Sbjct: 65 RNCL---EKLKVLVPLGPET-----------SRHTTL---GLLTKAKRFIKSLEERERKH 107 Query: 563 AVHQD 577 AVH++ Sbjct: 108 AVHKE 112 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 593 EGSRGGLGGPR 561 +GS GG GGPR Sbjct: 144 DGSPGGNGGPR 154 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 593 EGSRGGLGGPR 561 +GS GG GGPR Sbjct: 144 DGSPGGNGGPR 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,253 Number of Sequences: 438 Number of extensions: 3232 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -