BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30102.Seq (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 26 0.80 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 3.2 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 5.6 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 7.4 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 23 9.8 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 23 9.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 26.2 bits (55), Expect = 0.80 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 353 KLNDDFGTGPDEDLSFPSLFS 415 +L DDF TGPD + + P++FS Sbjct: 609 ELRDDFPTGPDPNFN-PNIFS 628 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 466 AMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKV 365 A+ +N+L+ + A+KR + Q L+R C K+ Sbjct: 598 ALRTLNLLNRSTDHALLAQKRQEHQRLVRECDKI 631 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 5.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 224 VPINDIERWTNLLPSRQFGYLVLXTSGGIMXHEEAR 117 V +ND+ERW + + VL SG + +E R Sbjct: 304 VSVNDLERWRDRIHEAIDQGFVLDKSGNRIMLDEQR 339 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.0 bits (47), Expect = 7.4 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -2 Query: 284 DCCKSHRQTKKCGVISPRFDVPINDIER 201 D C + + ++CG P+ +ND+ + Sbjct: 33 DLCGPNEEFQECGTACPKTCADLNDLPK 60 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 227 DVPINDIERWTN 192 D+P +D E+WT+ Sbjct: 165 DIPFSDFEQWTS 176 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 227 DVPINDIERWTN 192 D+P +D E+WT+ Sbjct: 165 DIPFSDFEQWTS 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 485,468 Number of Sequences: 2352 Number of extensions: 8963 Number of successful extensions: 20 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -