BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30102.Seq (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.3 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 3.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.1 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 412 QHYV*ILRRHSIRSYAPWLRFSSRFVANRIXRGARYPIRP 531 Q Y + + ++ ++ FS + + I R +RYP+RP Sbjct: 88 QRYGALCKEEALWNFPMISVFSRQDIETIIRRNSRYPLRP 127 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 499 FGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKR 395 FGS+ A I+ ++ + SI NAE+RG R Sbjct: 197 FGSVAIAIAIVELIGIICALCLANSIKNAERRGYR 231 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 582 SHDVVKRRPVNCNTTHYRXNWVPGP 508 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = +2 Query: 287 ASSVIINDFKLSDVTVXHHH 346 A+ +++ F++ +VT+ HH Sbjct: 344 ANVAVLHSFQMKNVTIVDHH 363 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 397 FSLAFQHYV*ILRRHSIRSYAPWLRF 474 F LAF + + ++ I WLRF Sbjct: 56 FGLAFVQLINVNEKNQIMKSNVWLRF 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,419 Number of Sequences: 438 Number of extensions: 2202 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -