BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30101.Seq (454 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 23 1.6 AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 23 1.6 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 6.3 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 6.3 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 33 LLFCAMCILVYGNSEDDFCEIDSIEQEDPCRR 128 LLF AM ++ ED+F ++ E E+ R Sbjct: 9 LLFMAMVAIMAAPVEDEFEPLEHFENEERADR 40 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 33 LLFCAMCILVYGNSEDDFCEIDSIEQEDPCRR 128 LLF AM ++ ED+F ++ E E+ R Sbjct: 9 LLFMAMVAIMAAPVEDEFEPLEHFENEERADR 40 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 375 TVYCYTKIQQSXPSGQSEA 319 T C++ + + PSGQ++A Sbjct: 75 TAGCHSNLLSTSPSGQNKA 93 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 375 TVYCYTKIQQSXPSGQSEA 319 T C++ + + PSGQ++A Sbjct: 75 TAGCHSNLLSTSPSGQNKA 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,585 Number of Sequences: 438 Number of extensions: 2088 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -