BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30100.Seq (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 82 3e-16 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 82 3e-16 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 79 2e-15 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 79 2e-15 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 79 2e-15 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 77 9e-15 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 73 2e-13 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 69 2e-12 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 69 2e-12 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 66 2e-11 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 62 3e-10 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 58 3e-09 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 56 2e-08 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 48 5e-06 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 3e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 5e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 5e-04 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 41 7e-04 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 40 0.001 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 39 0.002 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 39 0.003 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 38 0.004 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 38 0.007 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 37 0.009 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.009 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.009 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.009 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 36 0.015 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.020 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.020 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.020 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 36 0.026 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 35 0.035 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 35 0.035 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.035 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 35 0.046 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 35 0.046 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 35 0.046 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 34 0.080 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.14 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.14 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 33 0.14 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.14 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.19 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.19 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.24 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 31 0.57 At3g19780.1 68416.m02504 expressed protein 31 0.57 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 31 0.57 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.57 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 0.75 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 31 0.75 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.75 At3g63440.1 68416.m07143 FAD-binding domain-containing protein /... 30 0.99 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 0.99 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 0.99 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 1.7 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 1.7 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 29 3.0 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 29 3.0 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 29 3.0 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 4.0 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 5.3 At2g27350.3 68415.m03293 OTU-like cysteine protease family prote... 28 5.3 At2g27350.2 68415.m03292 OTU-like cysteine protease family prote... 28 5.3 At2g27350.1 68415.m03291 OTU-like cysteine protease family prote... 28 5.3 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 7.0 At2g29800.1 68415.m03620 kelch repeat-containing F-box family pr... 27 9.2 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 9.2 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 81.8 bits (193), Expect = 3e-16 Identities = 33/81 (40%), Positives = 56/81 (69%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435 LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP +T Sbjct: 156 LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYNLT 215 Query: 436 SAEQAKELIDANTVIVFGFFS 498 + + A++++ + +V G+ + Sbjct: 216 TLDDAEKVLTSGNKVVLGYLN 236 Score = 80.2 bits (189), Expect = 9e-16 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = +2 Query: 56 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 224 TKLAEE 241 T+L E+ Sbjct: 147 TELKED 152 Score = 51.6 bits (118), Expect = 4e-07 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = +2 Query: 74 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L + Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 245 S 247 S Sbjct: 493 S 493 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 81.8 bits (193), Expect = 3e-16 Identities = 33/81 (40%), Positives = 56/81 (69%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435 LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP +T Sbjct: 156 LAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYNLT 215 Query: 436 SAEQAKELIDANTVIVFGFFS 498 + + A++++ + +V G+ + Sbjct: 216 TLDDAEKVLTSGNKVVLGYLN 236 Score = 80.2 bits (189), Expect = 9e-16 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = +2 Query: 56 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 224 TKLAEE 241 T+L E+ Sbjct: 147 TELKED 152 Score = 51.6 bits (118), Expect = 4e-07 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = +2 Query: 74 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L + Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 245 S 247 S Sbjct: 493 S 493 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 79.4 bits (187), Expect = 2e-15 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 4/84 (4%) Frame = +1 Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 423 LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++GP + Sbjct: 84 LAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSGPAS 143 Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495 VE+ SA+ A E++ V+ G F Sbjct: 144 VEIKSADSATEVVGEKNVVAVGVF 167 Score = 74.5 bits (175), Expect = 5e-14 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = +2 Query: 38 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 212 AKAATKLAEEESPI 253 KAA++L+ P+ Sbjct: 69 EKAASELSSHNPPL 82 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +2 Query: 80 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP + A + S Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSV 425 Query: 251 I 253 I Sbjct: 426 I 426 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 411 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/84 (42%), Positives = 59/84 (70%), Gaps = 4/84 (4%) Frame = +1 Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 423 LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++GP + Sbjct: 85 LAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144 Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495 E+ SA+ A E++ V+V G F Sbjct: 145 AEIKSADDASEVVSDKKVVVVGIF 168 Score = 79.0 bits (186), Expect = 2e-15 Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 6/98 (6%) Frame = +2 Query: 38 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 200 APEYAKAATKLAEEESPIN*RKLTQLKNRISPRATVYE 313 APEY KAA+ L+ P+ K+ + AT YE Sbjct: 66 APEYEKAASALSSNVPPVVLAKIDASEETNREFATQYE 103 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +2 Query: 80 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP + A + S Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427 Query: 251 I 253 + Sbjct: 428 V 428 Score = 35.1 bits (77), Expect = 0.035 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 402 S +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 426 SVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/84 (42%), Positives = 59/84 (70%), Gaps = 4/84 (4%) Frame = +1 Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 423 LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++GP + Sbjct: 85 LAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144 Query: 424 VEVTSAEQAKELIDANTVIVFGFF 495 E+ SA+ A E++ V+V G F Sbjct: 145 AEIKSADDASEVVSDKKVVVVGIF 168 Score = 79.0 bits (186), Expect = 2e-15 Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 6/98 (6%) Frame = +2 Query: 38 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 200 APEYAKAATKLAEEESPIN*RKLTQLKNRISPRATVYE 313 APEY KAA+ L+ P+ K+ + AT YE Sbjct: 66 APEYEKAASALSSNVPPVVLAKIDASEETNREFATQYE 103 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +2 Query: 80 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP + A + S Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427 Query: 251 I 253 + Sbjct: 428 V 428 Score = 43.6 bits (98), Expect = 1e-04 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 4/74 (5%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---TG 414 S +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K G Sbjct: 426 SVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVG 485 Query: 415 PPAVEVTSAEQAKE 456 P E + E+ K+ Sbjct: 486 EPKKEEETTEEVKD 499 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 77.0 bits (181), Expect = 9e-15 Identities = 35/82 (42%), Positives = 53/82 (64%), Gaps = 1/82 (1%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 432 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 433 TSAEQAKELIDANTVIVFGFFS 498 T+ E+A+ ++ A +VFGF + Sbjct: 211 TTKEEAERVLSAEPKLVFGFLN 232 Score = 63.7 bits (148), Expect = 9e-11 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +2 Query: 89 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 47.2 bits (107), Expect = 8e-06 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 11 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 181 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 182 GHCKSLAPEYAK 217 GHC+S P Y K Sbjct: 468 GHCQSFEPIYNK 479 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 72.5 bits (170), Expect = 2e-13 Identities = 29/83 (34%), Positives = 49/83 (59%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426 S +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P + Sbjct: 129 SVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPII 188 Query: 427 EVTSAEQAKELIDANTVIVFGFF 495 + + ++A +D V G F Sbjct: 189 TLNTVDEAPRFLDKYHTFVLGLF 211 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +2 Query: 98 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 VL L+ + VI E+++V YAPWC L P +A+AAT L E S + Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSV 130 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 69.3 bits (162), Expect = 2e-12 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 92 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE + Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVV 195 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/71 (45%), Positives = 42/71 (59%) Frame = +2 Query: 35 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 215 KAATKLAEEES 247 K + +S Sbjct: 64 KLGASFKKAKS 74 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 414 +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 196 IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 5e-06 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414 S +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 74 SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 69.3 bits (162), Expect = 2e-12 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 92 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE + Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVV 195 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/71 (45%), Positives = 42/71 (59%) Frame = +2 Query: 35 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 215 KAATKLAEEES 247 K + +S Sbjct: 64 KLGASFKKAKS 74 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 414 +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 196 IANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 5e-06 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414 S +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 74 SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 65.7 bits (153), Expect = 2e-11 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = +2 Query: 74 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE AA LA+ + PI Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPI 85 Query: 254 N*RKL 268 KL Sbjct: 86 VIAKL 90 Score = 51.2 bits (117), Expect = 5e-07 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 3/87 (3%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435 +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK P + Sbjct: 87 IAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVAVLE 146 Query: 436 SAEQAKELI-DANTV--IVFGFFSDQS 507 S KE + DA T + GF ++S Sbjct: 147 SDSTVKEFVEDAGTFFPVFIGFGLNES 173 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 62.1 bits (144), Expect = 3e-10 Identities = 24/83 (28%), Positives = 48/83 (57%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426 S +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG + Sbjct: 127 SVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTI 186 Query: 427 EVTSAEQAKELIDANTVIVFGFF 495 ++ + ++A + + + G F Sbjct: 187 KLDTVDEASGFLKKHHTFILGLF 209 Score = 44.4 bits (100), Expect = 6e-05 Identities = 21/52 (40%), Positives = 30/52 (57%) Frame = +2 Query: 98 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E S + Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSV 128 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 58.4 bits (135), Expect = 3e-09 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +2 Query: 107 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA L Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210 Score = 54.8 bits (126), Expect = 4e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 98 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K A+ L Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 408 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +2 Query: 107 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 98 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K A L Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 408 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 48.0 bits (109), Expect = 5e-06 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +2 Query: 71 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKERY 191 Query: 245 SP 250 P Sbjct: 192 DP 193 Score = 41.1 bits (92), Expect = 5e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 89 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.1 bits (92), Expect = 5e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 89 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.1 bits (92), Expect = 5e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 89 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 223 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 40.7 bits (91), Expect = 7e-04 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 77 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235 E+ NV+ LSK E ++ E LV YAPWC C+++ Y + A KLA Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +2 Query: 14 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 187 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 188 CKSLAPEYAK 217 C+ LAP+ K Sbjct: 153 CRELAPDVYK 162 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 113 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244 K+ + T + +++EF A WCG CK+L P+ + A K + E Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVE 92 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +2 Query: 41 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 215 KAATKLAEEESP 250 KAA + + P Sbjct: 182 KAANIIKQRYDP 193 Score = 35.1 bits (77), Expect = 0.035 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 10/64 (15%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWLKK 405 L VD T+E L + ++GYP+++ FR GS + Y G R D I+ ++ Sbjct: 201 LGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMVEG 260 Query: 406 KTGP 417 P Sbjct: 261 LVAP 264 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 86 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 393 ++ K++ + YGVR PT+ F NG D G + D ++ Sbjct: 125 FKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 37.5 bits (83), Expect = 0.007 Identities = 13/42 (30%), Positives = 28/42 (66%) Frame = +2 Query: 113 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238 K+ F+++ + + ++++F A WCG CK++ P + A+K +E Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 37.1 bits (82), Expect = 0.009 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 92 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235 EN++ LS+ E ++ E +V YAPWC C+++ Y + A KLA Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +2 Query: 86 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 205 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +2 Query: 107 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 205 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357 ++ K++ + + A YG+R PT+ F+ G D Sbjct: 137 FKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.009 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 229 + + I+++F A WC C+ +AP + A K Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.3 bits (80), Expect = 0.015 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 10/64 (15%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWLKK 405 L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ +++ Sbjct: 202 LGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMVEE 261 Query: 406 KTGP 417 P Sbjct: 262 LLKP 265 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250 L+ A FE + ++V FYAPWC L P + KA+ E +P Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQITRERYNP 194 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.9 bits (79), Expect = 0.020 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +2 Query: 77 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 223 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + A Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.020 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 442 EQA 450 E A Sbjct: 113 EPA 115 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.020 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 301 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 450 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 35.5 bits (78), Expect = 0.026 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 59 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 230 L 232 L Sbjct: 395 L 395 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 35.1 bits (77), Expect = 0.035 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKL 232 ++V+F A WCG C+ +AP +A A KL Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKL 57 Score = 31.1 bits (67), Expect = 0.57 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 35.1 bits (77), Expect = 0.035 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244 ++V+F++P CG CK+L P+ K A K E E Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVE 146 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.1 bits (77), Expect = 0.035 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 128 TVITTTEYILVEFYAPWCGHCKSLAP 205 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 34.7 bits (76), Expect = 0.046 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 34.7 bits (76), Expect = 0.046 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.7 bits (76), Expect = 0.046 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAA 223 ++V+FY WCG C+++ P+ K A Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 394 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFF 495 W ++K GP +++TSAEQ L DA + +++ F+ Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFY 121 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.9 bits (74), Expect = 0.080 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++++ Y WCG CK +AP+Y + + K Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 262 KVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 393 K+D Q+ + LA+ G+R PT K ++ + G + +D+++ Sbjct: 133 KLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 33.1 bits (72), Expect = 0.14 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++++ Y WCG CK +AP+Y + K Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEK 115 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.1 bits (72), Expect = 0.14 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 119 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 156 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 33.1 bits (72), Expect = 0.14 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.1 bits (72), Expect = 0.14 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 140 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253 T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.19 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 119 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 205 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.3 bits (70), Expect = 0.24 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 390 Q+ K+D + +A Y + PT F++G P D + G A +I Sbjct: 115 QVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 32.7 bits (71), Expect = 0.19 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414 K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 63 KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 I+++F A WC C+ +AP +A+ A K Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKK 55 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.24 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAP 205 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.1 bits (67), Expect = 0.57 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441 +V+A + +++E+Y V P FF++G +D G AD S L K G A +T A Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 31.1 bits (67), Expect = 0.57 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238 +L++ NF + I ++L+ PWCG +SL E + + E Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREE 73 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 31.1 bits (67), Expect = 0.57 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 +++ F A WCG C+ ++P Y+ AT+ Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320 Score = 30.3 bits (65), Expect = 0.99 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357 KVD + D+A S+ + PT F R+G +D Sbjct: 328 KVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.57 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 125 ETVITTTEYILVEFYAPWCGHCK 193 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 30.7 bits (66), Expect = 0.75 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 I+++F A WC C+ +AP +A A K Sbjct: 30 IVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405 KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 30.7 bits (66), Expect = 0.75 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 119 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229 +F + + + ++V+F A WCG C+ + P A K Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK 75 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.75 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g63440.1 68416.m07143 FAD-binding domain-containing protein / cytokinin oxidase family protein similar to cytokinin oxidase, Zea mays, EMBL:ZMY18377 [gi:3882018] [gi:3441978] Length = 504 Score = 30.3 bits (65), Expect = 0.99 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -2 Query: 288 ILFLSCVNFR*LIGDSSSASFVAALAYSGARDLQWPHHGA*NSTKMYSVVVITV 127 IL LSC+ F+ SSS S + AL G + + HH + + Y ++ + V Sbjct: 9 ILLLSCIAFKLACCFSSSISSLKALPLVGHLEFEHVHHASKDFGNRYQLIPLAV 62 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 30.3 bits (65), Expect = 0.99 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++V+FYA WCG C +A E A + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVE 122 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 351 + KVD E + A VRG PTL FF + P Sbjct: 129 IVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 30.3 bits (65), Expect = 0.99 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAA 223 ++V+F++P CG CK+L P+ + A Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229 ++ F A WCG CK +AP + + + K Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEK 73 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 143 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241 T +++V F A WCG C+ + P K ++ E Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 98 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429 ++ +VD + + + YPT F NG + Y G R + + +++ ++T A E Sbjct: 79 EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137 Query: 430 VTSAEQAKEL 459 E KEL Sbjct: 138 KAQLED-KEL 146 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 98 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429 ++ +VD + + + YPT F NG + Y G R + + +++ ++T A E Sbjct: 79 EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137 Query: 430 VTSAEQAKEL 459 E KEL Sbjct: 138 KAQLED-KEL 146 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 98 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 199 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 429 ++ +VD + + + YPT F NG + Y G R + + +++ ++T A E Sbjct: 79 EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAAE 137 Query: 430 VTSAEQAKEL 459 E KEL Sbjct: 138 KAQLED-KEL 146 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 464 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 363 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At2g27350.3 68415.m03293 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 506 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%) Frame = +1 Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306 +Y+HG H++ S+V P +++ G G + R + + K + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380 Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.2 68415.m03292 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%) Frame = +1 Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306 +Y+HG H++ S+V P +++ G G + R + + K + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380 Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.1 68415.m03291 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%) Frame = +1 Query: 133 NYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRISYQLAK--VDATQEQDLAESYG 306 +Y+HG H++ S+V P +++ G G + R + + K + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLT-VGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALL 380 Query: 307 VRG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 444 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 381 AEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 354 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At2g29800.1 68415.m03620 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 414 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 486 WFLFGPELARAKTFLSTAQVVDDQVFAIVSDE 581 W +GPE A+ + ++ VVDD ++AIV E Sbjct: 282 WETWGPESAQRSYWHLSSCVVDDLLYAIVPRE 313 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354 S KVD + + + VR PT+K ++NGS + Sbjct: 644 SIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,074,559 Number of Sequences: 28952 Number of extensions: 239247 Number of successful extensions: 802 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 794 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -