BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30098.Seq (617 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 26 0.34 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 26 0.34 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 25 0.59 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 23 3.2 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.8 bits (54), Expect = 0.34 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 528 LPPRRRNCCRPSLEKTKPRLPLRSK 602 + PR++NCCR L K P RSK Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.8 bits (54), Expect = 0.34 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 528 LPPRRRNCCRPSLEKTKPRLPLRSK 602 + PR++NCCR L K P RSK Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 25.0 bits (52), Expect = 0.59 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%) Frame = +3 Query: 417 EYIHRKKAEK----ARTKMLSDQAEA--RRNKVKEARSA--ARNVLPPRRRNCCRPSLEK 572 EYI R++ E A T + D +R K K+++ + N L RR R LEK Sbjct: 11 EYIERREREAEHGYASTMPMPDDMRTVTKRPKTKKSQGSRTTHNELEKNRRAHLRNCLEK 70 Query: 573 TKPRLPL 593 K +PL Sbjct: 71 LKVLVPL 77 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -2 Query: 355 RCLSIFLAVLYFRSNFLRTL----CLCTHSSFCGIRALQY 248 RC+ +FL+V+ S F+ + C ++ C R Q+ Sbjct: 6 RCIYLFLSVILITSYFVTPVMPCNCKAPETALCARRCQQH 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,345 Number of Sequences: 438 Number of extensions: 3768 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -