BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30097.Seq (631 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 41 3e-05 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 4.6 AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 pr... 23 6.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.0 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 8.0 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 41.1 bits (92), Expect = 3e-05 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 9/100 (9%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPS---------PPADTFLPA 357 +Q+QADL GIPV+R + E ALG A+ A +A V + + +TFLP Sbjct: 434 MQLQADLSGIPVLRTEVHEPAALGTAMAAAQANGVDLYKLEAEIRGYAGVQSHHETFLPT 493 Query: 356 LTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELL 237 T A+ + +GW +K + + LL Sbjct: 494 TTEEERNARYTKWKMAVQRSLGWAVSKKSEAMTDERYSLL 533 Score = 32.7 bits (71), Expect = 0.010 Identities = 21/42 (50%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509 VRAALEAVC QTR L +L DG MA NS+L Sbjct: 392 VRAALEAVCFQTRDIIEAMKKDCGINLNKLHTDGIMASNSLL 433 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 368 MYRPVGWVLSWATHALRDLRQW 433 +Y P + W H +RDLR W Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 368 MYRPVGWVLSWATHALRDLRQW 433 +Y P + W H +RDLR W Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577 >AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 420 SRNACVAHDNTQPTGRYIP 364 +R AC++ DN Q R++P Sbjct: 17 TRVACLSEDNFQQADRFLP 35 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 407 VWPTTIPSPPADTFLPAL 354 V+P+ +P P D++ PAL Sbjct: 302 VFPSVVPLVPLDSYHPAL 319 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 8.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 Query: 615 RPCVTRRAPWRTRWLQTARP*GNSSPTEGWRRTQ 514 RP RRAP R R G + GWR+++ Sbjct: 167 RPYRVRRAPRAERRHPYTRRSGGQQRSAGWRQSR 200 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,979 Number of Sequences: 2352 Number of extensions: 15046 Number of successful extensions: 39 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -