BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30080.Seq (853 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6006| Best HMM Match : Annexin (HMM E-Value=2.4e-25) 29 4.8 SB_28488| Best HMM Match : PAX (HMM E-Value=0) 29 6.3 >SB_6006| Best HMM Match : Annexin (HMM E-Value=2.4e-25) Length = 803 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +1 Query: 205 KARXQAKGLXKXDQXGRKEDKGKPEXKPAKGVTVPTRKGIKETQNVKSQXIKSGEQQK 378 K + Q K + GRKE+K K E K ++ K+ N K + KS E++K Sbjct: 285 KGQGQKVEKAKKQEKGRKEEKSKKEEKEKN--KAGGKEAKKDKANEKDKDAKSKEEEK 340 >SB_28488| Best HMM Match : PAX (HMM E-Value=0) Length = 551 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +1 Query: 235 KXDQXGRKEDKGKPEXKPAKGVTVPTRKGIKETQNVKSQXIKSGEQQKG 381 K ++ ++DKGK + K K ++P+R + ++ S K ++ G Sbjct: 171 KKERKDEEDDKGKEDEKVEKNSSLPSRHNFSSSYSIASILKKPSAEEDG 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,924,680 Number of Sequences: 59808 Number of extensions: 297349 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -