BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30079.Seq (413 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 38 0.002 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.017 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 36 0.017 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.023 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 35 0.023 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 35 0.023 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 35 0.030 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 35 0.030 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 35 0.030 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 34 0.040 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 34 0.040 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 34 0.040 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 34 0.040 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 34 0.040 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 34 0.040 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 34 0.040 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 34 0.040 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 34 0.040 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.040 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 34 0.053 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 34 0.053 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 34 0.053 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 34 0.053 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 34 0.053 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 34 0.053 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 34 0.053 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 34 0.053 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 34 0.053 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 34 0.053 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.053 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.070 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 33 0.070 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 33 0.070 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.070 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.070 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.070 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 33 0.070 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 33 0.070 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.093 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.093 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.093 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.093 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.093 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.093 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.093 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.093 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.093 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.093 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.093 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.093 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 33 0.093 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.093 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.093 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.093 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.093 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 33 0.093 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.093 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 33 0.093 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.093 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 33 0.093 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 33 0.093 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 33 0.093 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 33 0.093 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 33 0.093 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.093 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = -1 Query: 110 FKLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 F+ G+LTT +R L+ NSC+PG PL+LERPP Sbjct: 7 FRCGHLTTNAAT-RVRFPLISNSCSPGDPLVLERPP 41 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3 N + R LV NSC+PG PL+LERPP Sbjct: 17 NPNTRAHLVSNSCSPGDPLVLERPP 41 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 ++ D+L L NSC+PG PL+LERPP Sbjct: 6 YETDALPTALTSNSCSPGDPLVLERPP 32 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = -1 Query: 101 GNLTTVFDNDSLRGL---LVPNSCTPGXPLLLERPP 3 GNL VF D +R L L+ NSC+PG PL+LERPP Sbjct: 20 GNLDDVFVRD-IRILFLDLISNSCSPGDPLVLERPP 54 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -1 Query: 98 NLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 N+ T + S R LV NSC+PG PL+LERPP Sbjct: 12 NIPTRYAILSPRARLVSNSCSPGDPLVLERPP 43 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 38.3 bits (85), Expect = 0.002 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -1 Query: 89 TVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 +++ ++ ++ L NSC+PG PL+LERPP Sbjct: 85 SIYGHEDIKRALASNSCSPGDPLVLERPP 113 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.003 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R +LV NSC+PG PL+LERPP Sbjct: 23 RPMLVSNSCSPGDPLVLERPP 43 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.004 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 LLV NSC+PG PL+LERPP Sbjct: 16 LLVSNSCSPGDPLVLERPP 34 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.5 bits (83), Expect = 0.004 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3 +L L++ NSC+PG PL+LERPP Sbjct: 21 TLGSLIISNSCSPGDPLVLERPP 43 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.006 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = -1 Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3 +++LR +LV NSC+PG PL+LERPP Sbjct: 3 HNTLR-ILVSNSCSPGDPLVLERPP 26 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.006 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -1 Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3 N +RG NSC+PG PL+LERPP Sbjct: 11 NPEVRGSKPSNSCSPGDPLVLERPP 35 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.7 bits (81), Expect = 0.008 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 74 DSLRG-LLVPNSCTPGXPLLLERPP 3 D +G LL NSC+PG PL+LERPP Sbjct: 71 DECKGILLTSNSCSPGDPLVLERPP 95 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.008 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -1 Query: 86 VFDNDSLRGLLVPNSCTPGXPLLLERPP 3 VF ++S V NSC+PG PL+LERPP Sbjct: 21 VFYSNSTPHFRVSNSCSPGDPLVLERPP 48 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.008 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +LV NSC+PG PL+LERPP Sbjct: 4 MLVSNSCSPGDPLVLERPP 22 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.008 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +LV NSC+PG PL+LERPP Sbjct: 1 MLVSNSCSPGDPLVLERPP 19 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.008 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 92 TTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3 T + N LRG+ NSC+PG PL+LERPP Sbjct: 7 TLISANIRLRGICAASNSCSPGDPLVLERPP 37 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.010 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 RG+ NSC+PG PL+LERPP Sbjct: 30 RGVHASNSCSPGDPLVLERPP 50 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 36.3 bits (80), Expect = 0.010 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3 D+ LL NSC+PG PL+LERPP Sbjct: 82 DASNLLLTSNSCSPGDPLVLERPP 105 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.010 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3 +L L+ NSC+PG PL+LERPP Sbjct: 2 ALSSFLLSNSCSPGDPLVLERPP 24 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 L L+ NSC+PG PL+LERPP Sbjct: 13 LISFLISNSCSPGDPLVLERPP 34 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 8 LFVSNSCSPGDPLVLERPP 26 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 LV NSC+PG PL+LERPP Sbjct: 3 LVSNSCSPGDPLVLERPP 20 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 L+ L+ NSC+PG PL+LERPP Sbjct: 16 LKLLITSNSCSPGDPLVLERPP 37 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R L + NSC+PG PL+LERPP Sbjct: 4 RRLFLSNSCSPGDPLVLERPP 24 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.013 Identities = 15/21 (71%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -1 Query: 62 GLLVP-NSCTPGXPLLLERPP 3 GL +P NSC+PG PL+LERPP Sbjct: 4 GLFLPSNSCSPGDPLVLERPP 24 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G V NSC+PG PL+LERPP Sbjct: 31 GFKVSNSCSPGDPLVLERPP 50 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 LL NSC+PG PL+LERPP Sbjct: 4 LLASNSCSPGDPLVLERPP 22 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 +R L+ NSC+PG PL+LERPP Sbjct: 4 VRIYLISNSCSPGDPLVLERPP 25 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.013 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -1 Query: 86 VFDNDSLRGLLVPNSCTPGXPLLLERPP 3 V D D+L NSC+PG PL+LERPP Sbjct: 31 VLDLDALDTTQGSNSCSPGDPLVLERPP 58 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.013 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F+N R V NSC+PG PL+LERPP Sbjct: 5 FENRIGRCWQVSNSCSPGDPLVLERPP 31 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 35.9 bits (79), Expect = 0.013 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 LR L NSC+PG PL+LERPP Sbjct: 31 LRKLCESNSCSPGDPLVLERPP 52 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.013 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 107 KLGNLTTVFDNDSLR-GLLVPNSCTPGXPLLLERPP 3 KL + V D L G + NSC+PG PL+LERPP Sbjct: 4 KLTEMCAVRDTSILSAGRSLSNSCSPGDPLVLERPP 39 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 + L + NSC+PG PL+LERPP Sbjct: 97 KSLKISNSCSPGDPLVLERPP 117 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 35.5 bits (78), Expect = 0.017 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 95 LTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 +T + + G NSC+PG PL+LERPP Sbjct: 465 VTRLLQGEIASGQTTSNSCSPGDPLVLERPP 495 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3 S + + NSC+PG PL+LERPP Sbjct: 41 SKKNFFISNSCSPGDPLVLERPP 63 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.5 bits (78), Expect = 0.017 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +++ NSC+PG PL+LERPP Sbjct: 13 IIISNSCSPGDPLVLERPP 31 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.017 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -1 Query: 80 DNDSLRGLL-VPNSCTPGXPLLLERPP 3 +N SL+ + NSC+PG PL+LERPP Sbjct: 22 ENSSLKPTFSISNSCSPGDPLVLERPP 48 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.017 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 2 LYVSNSCSPGDPLVLERPP 20 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L+ NSC+PG PL+LERPP Sbjct: 5 ILLSNSCSPGDPLVLERPP 23 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 35.5 bits (78), Expect = 0.017 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -1 Query: 110 FKLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 FK+ N + + L NSC+PG PL+LERPP Sbjct: 208 FKVSNTPAAEQRNYTQLLESSNSCSPGDPLVLERPP 243 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 40 LISNSCSPGDPLVLERPP 57 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 70 LISNSCSPGDPLVLERPP 87 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 34 LISNSCSPGDPLVLERPP 51 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.017 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + +V NSC+PG PL+LERPP Sbjct: 4 FTDTLISANIVSNSCSPGDPLVLERPP 30 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 21 LISNSCSPGDPLVLERPP 38 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 16 LISNSCSPGDPLVLERPP 33 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.017 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 31 LISNSCSPGDPLVLERPP 48 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = -1 Query: 80 DNDSLRGLLVP---NSCTPGXPLLLERPP 3 DN + LVP NSC+PG PL+LERPP Sbjct: 14 DNGTNGASLVPRPSNSCSPGDPLVLERPP 42 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 347 IVSNSCSPGDPLVLERPP 364 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 LL NSC+PG PL+LERPP Sbjct: 24 LLPSNSCSPGDPLVLERPP 42 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 38 LRVSNSCSPGDPLVLERPP 56 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.1 bits (77), Expect = 0.023 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +++ NSC+PG PL+LERPP Sbjct: 13 IVISNSCSPGDPLVLERPP 31 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 +R + NSC+PG PL+LERPP Sbjct: 3 MRVIFTSNSCSPGDPLVLERPP 24 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 77 IVSNSCSPGDPLVLERPP 94 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G+ NSC+PG PL+LERPP Sbjct: 7 GIKTSNSCSPGDPLVLERPP 26 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + ++ NSC+PG PL+LERPP Sbjct: 4 FTDTLISANIISNSCSPGDPLVLERPP 30 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++V NSC+PG PL+LERPP Sbjct: 6 VVVSNSCSPGDPLVLERPP 24 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 11 MVSNSCSPGDPLVLERPP 28 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 +R L NSC+PG PL+LERPP Sbjct: 24 IRSLQRSNSCSPGDPLVLERPP 45 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 95 LTTVFDND-SLRGLLVPNSCTPGXPLLLERPP 3 LT V N +L ++ NSC+PG PL+LERPP Sbjct: 51 LTLVITNLLALTVFMLSNSCSPGDPLVLERPP 82 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 1 MVSNSCSPGDPLVLERPP 18 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.1 bits (77), Expect = 0.023 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +++ NSC+PG PL+LERPP Sbjct: 4 VIISNSCSPGDPLVLERPP 22 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G+ NSC+PG PL+LERPP Sbjct: 8 GIRTSNSCSPGDPLVLERPP 27 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 16 LKVSNSCSPGDPLVLERPP 34 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 85 IVSNSCSPGDPLVLERPP 102 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 10 MLASNSCSPGDPLVLERPP 28 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 80 DN-DSLRGLLVPNSCTPGXPLLLERPP 3 DN + R L NSC+PG PL+LERPP Sbjct: 5 DNLEGSRRLQTSNSCSPGDPLVLERPP 31 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 6 IVSNSCSPGDPLVLERPP 23 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 1 MVSNSCSPGDPLVLERPP 18 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 LL NSC+PG PL+LERPP Sbjct: 21 LLPSNSCSPGDPLVLERPP 39 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -1 Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3 D + ++ + + NSC+PG PL+LERPP Sbjct: 59 DLNIIQKIKISNSCSPGDPLVLERPP 84 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + ++ NSC+PG PL+LERPP Sbjct: 4 FTDTLISANIISNSCSPGDPLVLERPP 30 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 7 LRVSNSCSPGDPLVLERPP 25 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.023 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +++ NSC+PG PL+LERPP Sbjct: 24 IVISNSCSPGDPLVLERPP 42 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 144 LITSNSCSPGDPLVLERPP 162 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -1 Query: 77 NDSLRGLL-VPNSCTPGXPLLLERPP 3 N S + LL + NSC+PG PL+LERPP Sbjct: 3 NQSKQCLLEISNSCSPGDPLVLERPP 28 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.1 bits (77), Expect = 0.023 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 5 LITSNSCSPGDPLVLERPP 23 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.030 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 17 IISNSCSPGDPLVLERPP 34 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 890 LVTSNSCSPGDPLVLERPP 908 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 62 LLSNSCSPGDPLVLERPP 79 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 34.7 bits (76), Expect = 0.030 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 119 IISNSCSPGDPLVLERPP 136 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.7 bits (76), Expect = 0.030 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 74 DSLRGLLVP-NSCTPGXPLLLERPP 3 D LR +V NSC+PG PL+LERPP Sbjct: 82 DLLRPCIVTSNSCSPGDPLVLERPP 106 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 3474 VVSNSCSPGDPLVLERPP 3491 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 3 LHVSNSCSPGDPLVLERPP 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 5 LHVSNSCSPGDPLVLERPP 23 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 68 LRGLLVPNSCTPGXPLLLERPP 3 L L NSC+PG PL+LERPP Sbjct: 2 LYNTLASNSCSPGDPLVLERPP 23 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L + NSC+PG PL+LERPP Sbjct: 4 LFLSNSCSPGDPLVLERPP 22 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 54 LLSNSCSPGDPLVLERPP 71 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 2 LLSNSCSPGDPLVLERPP 19 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 16 VLASNSCSPGDPLVLERPP 34 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 19 VVSNSCSPGDPLVLERPP 36 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G + NSC+PG PL+LERPP Sbjct: 10 GFVPSNSCSPGDPLVLERPP 29 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 34.7 bits (76), Expect = 0.030 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3 DS V NSC+PG PL+LERPP Sbjct: 7 DSNMCSFVSNSCSPGDPLVLERPP 30 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G + NSC+PG PL+LERPP Sbjct: 14 GPITSNSCSPGDPLVLERPP 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 36 VLTSNSCSPGDPLVLERPP 54 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.030 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F+ DS + NSC+PG PL+LERPP Sbjct: 8 FEPDSNQRPRESNSCSPGDPLVLERPP 34 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + V NSC+PG PL+LERPP Sbjct: 30 IAVSNSCSPGDPLVLERPP 48 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L + NSC+PG PL+LERPP Sbjct: 169 LFLSNSCSPGDPLVLERPP 187 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3 + R V NSC+PG PL+LERPP Sbjct: 3 EEFRITAVSNSCSPGDPLVLERPP 26 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.030 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 1 MISNSCSPGDPLVLERPP 18 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 19 LVASNSCSPGDPLVLERPP 37 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L V NSC+PG PL+LERPP Sbjct: 12 LEVSNSCSPGDPLVLERPP 30 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 1 LLSNSCSPGDPLVLERPP 18 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.030 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 4 IISNSCSPGDPLVLERPP 21 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.030 Identities = 15/19 (78%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -1 Query: 56 LVP-NSCTPGXPLLLERPP 3 LVP NSC+PG PL+LERPP Sbjct: 27 LVPSNSCSPGDPLVLERPP 45 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3 N ++ + NSC+PG PL+LERPP Sbjct: 151 NKYIKQWIASNSCSPGDPLVLERPP 175 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 +V NSC+PG PL+LERPP Sbjct: 27 VVSNSCSPGDPLVLERPP 44 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect = 0.030 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 95 LTTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3 LTT ++ R + V NSC+PG PL+LERPP Sbjct: 36 LTTRIHYENKRRVYVTSNSCSPGDPLVLERPP 67 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 3 VLASNSCSPGDPLVLERPP 21 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 30 VSNSCSPGDPLVLERPP 46 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 7 VSNSCSPGDPLVLERPP 23 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R ++ NSC+PG PL+LERPP Sbjct: 43 RVVVTSNSCSPGDPLVLERPP 63 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + ++ NSC+PG PL+LERPP Sbjct: 4 FTDTLISANILSNSCSPGDPLVLERPP 30 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 2 VSNSCSPGDPLVLERPP 18 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.040 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + + NSC+PG PL+LERPP Sbjct: 7 ITISNSCSPGDPLVLERPP 25 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 117 VSNSCSPGDPLVLERPP 133 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 184 VSNSCSPGDPLVLERPP 200 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 1066 VSNSCSPGDPLVLERPP 1082 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 3 VSNSCSPGDPLVLERPP 19 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 214 VSNSCSPGDPLVLERPP 230 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 3 VSNSCSPGDPLVLERPP 19 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 64 VSNSCSPGDPLVLERPP 80 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G NSC+PG PL+LERPP Sbjct: 17 GRFASNSCSPGDPLVLERPP 36 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 19 VSNSCSPGDPLVLERPP 35 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 64 ILPSNSCSPGDPLVLERPP 82 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 11 VSNSCSPGDPLVLERPP 27 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 25 VSNSCSPGDPLVLERPP 41 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 59 VSNSCSPGDPLVLERPP 75 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 31 VSNSCSPGDPLVLERPP 47 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.040 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3 + D R NSC+PG PL+LERPP Sbjct: 18 NEDLARTCFSSNSCSPGDPLVLERPP 43 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.040 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 74 DSLRGLLVP-NSCTPGXPLLLERPP 3 D+L +P NSC+PG PL+LERPP Sbjct: 6 DTLISANIPSNSCSPGDPLVLERPP 30 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 41 VSNSCSPGDPLVLERPP 57 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 6 VSNSCSPGDPLVLERPP 22 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.3 bits (75), Expect = 0.040 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 5 VISNSCSPGDPLVLERPP 22 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.040 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 24 IITSNSCSPGDPLVLERPP 42 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 34.3 bits (75), Expect = 0.040 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F +S R + NSC+PG PL+LERPP Sbjct: 24 FSTESPRS--ISNSCSPGDPLVLERPP 48 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 20 LASNSCSPGDPLVLERPP 37 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 11 LTSNSCSPGDPLVLERPP 28 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 34.3 bits (75), Expect = 0.040 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R L + NSC+PG PL+LERPP Sbjct: 112 RLLGISNSCSPGDPLVLERPP 132 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 30 VSNSCSPGDPLVLERPP 46 >SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.040 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 98 NLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 N++ + SL NSC+PG PL+LERPP Sbjct: 12 NISPILPPLSLSRYAGSNSCSPGDPLVLERPP 43 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 17 VSNSCSPGDPLVLERPP 33 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 34 VSNSCSPGDPLVLERPP 50 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.3 bits (75), Expect = 0.040 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = -1 Query: 68 LRGLLVP---NSCTPGXPLLLERPP 3 LR L P NSC+PG PL+LERPP Sbjct: 56 LRSLYFPETSNSCSPGDPLVLERPP 80 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.040 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 17 VISNSCSPGDPLVLERPP 34 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 34.3 bits (75), Expect = 0.040 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + + NSC+PG PL+LERPP Sbjct: 88 MTISNSCSPGDPLVLERPP 106 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 8 VSNSCSPGDPLVLERPP 24 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 23 VSNSCSPGDPLVLERPP 39 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 18 VSNSCSPGDPLVLERPP 34 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 11 LASNSCSPGDPLVLERPP 28 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 3 LASNSCSPGDPLVLERPP 20 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 15 LTSNSCSPGDPLVLERPP 32 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.3 bits (75), Expect = 0.040 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = -1 Query: 107 KLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3 K+ TT N RG NSC+PG PL+LERPP Sbjct: 48 KITRKTTRMRNRITRG--GSNSCSPGDPLVLERPP 80 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 661 LASNSCSPGDPLVLERPP 678 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 34.3 bits (75), Expect = 0.040 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -1 Query: 110 FKLGNLTTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3 ++LG + +S+ P NSC+PG PL+LERPP Sbjct: 495 WRLGESGSASARESVPSSSTPSNSCSPGDPLVLERPP 531 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 27 VSNSCSPGDPLVLERPP 43 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 7 LASNSCSPGDPLVLERPP 24 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 193 VSNSCSPGDPLVLERPP 209 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -1 Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3 + L ++ NSC+PG PL+LERPP Sbjct: 260 EELEEIVGSNSCSPGDPLVLERPP 283 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 17 VSNSCSPGDPLVLERPP 33 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 11 LTSNSCSPGDPLVLERPP 28 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L + NSC+PG PL+LERPP Sbjct: 16 LALSNSCSPGDPLVLERPP 34 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.040 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 74 DSLRGLLVP-NSCTPGXPLLLERPP 3 D+L +P NSC+PG PL+LERPP Sbjct: 6 DTLISANIPSNSCSPGDPLVLERPP 30 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.040 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 V NSC+PG PL+LERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + + NSC+PG PL+LERPP Sbjct: 4 FTDTLISANIASNSCSPGDPLVLERPP 30 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 5 ISNSCSPGDPLVLERPP 21 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 1 MLRSNSCSPGDPLVLERPP 19 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 28 LTASNSCSPGDPLVLERPP 46 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 261 ISNSCSPGDPLVLERPP 277 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 16 ISNSCSPGDPLVLERPP 32 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.9 bits (74), Expect = 0.053 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + L NSC+PG PL+LERPP Sbjct: 14 FTGHAKNDALSSNSCSPGDPLVLERPP 40 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 21 ISNSCSPGDPLVLERPP 37 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 17 ISNSCSPGEPLVLERPP 33 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + + NSC+PG PL+LERPP Sbjct: 13 IFLSNSCSPGDPLVLERPP 31 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 59 ISNSCSPGDPLVLERPP 75 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R + NSC+PG PL+LERPP Sbjct: 79 RQQMASNSCSPGDPLVLERPP 99 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 10 IVTSNSCSPGDPLVLERPP 28 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + + NSC+PG PL+LERPP Sbjct: 48 IFLSNSCSPGDPLVLERPP 66 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 10 ISNSCSPGDPLVLERPP 26 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 3 ISNSCSPGDPLVLERPP 19 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.053 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = -1 Query: 59 LLVP--NSCTPGXPLLLERPP 3 LL P NSC+PG PL+LERPP Sbjct: 17 LLAPTSNSCSPGDPLVLERPP 37 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 55 ILSNSCSPGDPLVLERPP 72 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 33.9 bits (74), Expect = 0.053 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -1 Query: 71 SLRGLLV-PNSCTPGXPLLLERPP 3 +LR +V NSC+PG PL+LERPP Sbjct: 127 NLRARIVGSNSCSPGDPLVLERPP 150 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 13 ISNSCSPGDPLVLERPP 29 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 52 ISNSCSPGDPLVLERPP 68 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 51 ISNSCSPGDPLVLERPP 67 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 33.9 bits (74), Expect = 0.053 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -1 Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3 + ++ RG NSC+PG PL+LERPP Sbjct: 61 EGNTNRGKGGSNSCSPGDPLVLERPP 86 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 16 ISNSCSPGDPLVLERPP 32 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R + NSC+PG PL+LERPP Sbjct: 76 REVATSNSCSPGDPLVLERPP 96 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 2 VITSNSCSPGDPLVLERPP 20 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L + NSC+PG PL+LERPP Sbjct: 2 LSLSNSCSPGDPLVLERPP 20 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 21 ISNSCSPGDPLVLERPP 37 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 152 ISNSCSPGDPLVLERPP 168 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 + + NSC+PG PL+LERPP Sbjct: 33 IFLSNSCSPGDPLVLERPP 51 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 4 LTASNSCSPGDPLVLERPP 22 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 21 LTTSNSCSPGDPLVLERPP 39 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 7 ISNSCSPGDPLVLERPP 23 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 33.9 bits (74), Expect = 0.053 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -1 Query: 107 KLGNLTTVFDNDSLRGLLVP---NSCTPGXPLLLERPP 3 K+ + ++ LR +LV NSC+PG PL+LERPP Sbjct: 778 KIALMGLIYRKIFLRVMLVAISSNSCSPGDPLVLERPP 815 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 +L NSC+PG PL+LERPP Sbjct: 17 ILGSNSCSPGDPLVLERPP 35 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.053 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -1 Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3 D D+ R L NSC+PG PL+LERPP Sbjct: 16 DRDTDRHL--SNSCSPGDPLVLERPP 39 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 F + + + NSC+PG PL+LERPP Sbjct: 4 FTDTLISANITSNSCSPGDPLVLERPP 30 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 18 ISNSCSPGDPLVLERPP 34 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 32 ISNSCSPGDPLVLERPP 48 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3 D + NSC+PG PL+LERPP Sbjct: 2413 DTGGSSSAIASNSCSPGDPLVLERPP 2438 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.053 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = -1 Query: 62 GLLVP-NSCTPGXPLLLERPP 3 G L P NSC+PG PL+LERPP Sbjct: 3 GKLEPSNSCSPGDPLVLERPP 23 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3 S++ NSC+PG PL+LERPP Sbjct: 7 SIKQQATSNSCSPGDPLVLERPP 29 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 974 ISNSCSPGDPLVLERPP 990 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 6 ISNSCSPGDPLVLERPP 22 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L NSC+PG PL+LERPP Sbjct: 17 LTASNSCSPGDPLVLERPP 35 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3 + + L + NSC+PG PL+LERPP Sbjct: 51 YGGEILAAFELSNSCSPGDPLVLERPP 77 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.053 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 65 RGLLVPNSCTPGXPLLLERPP 3 R L NSC+PG PL+LERPP Sbjct: 12 RHLTGSNSCSPGDPLVLERPP 32 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 1 ISNSCSPGDPLVLERPP 17 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 5 ISNSCSPGDPLVLERPP 21 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 9 VITSNSCSPGDPLVLERPP 27 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 62 GLLVPNSCTPGXPLLLERPP 3 G+ NSC+PG PL+LERPP Sbjct: 28 GVTGSNSCSPGDPLVLERPP 47 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 14 ISNSCSPGDPLVLERPP 30 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 8 ISNSCSPGDPLVLERPP 24 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 52 ISNSCSPGDPLVLERPP 68 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.9 bits (74), Expect = 0.053 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 L+ NSC+PG PL+LERPP Sbjct: 53 LMRSNSCSPGDPLVLERPP 71 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 104 ILSNSCSPGDPLVLERPP 121 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 7 ISNSCSPGDPLVLERPP 23 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 56 LVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 12 ILSNSCSPGDPLVLERPP 29 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 6 ISNSCSPGDPLVLERPP 22 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 59 LLVPNSCTPGXPLLLERPP 3 ++ NSC+PG PL+LERPP Sbjct: 11 IVASNSCSPGDPLVLERPP 29 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 30 ISNSCSPGDPLVLERPP 46 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 46 ISNSCSPGDPLVLERPP 62 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 45 ISNSCSPGDPLVLERPP 61 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 33.9 bits (74), Expect = 0.053 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 53 VPNSCTPGXPLLLERPP 3 + NSC+PG PL+LERPP Sbjct: 591 ISNSCSPGDPLVLERPP 607 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,221,184 Number of Sequences: 59808 Number of extensions: 162175 Number of successful extensions: 2374 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2374 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -