Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    21   4.0  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    21   4.0  

>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 21.4 bits (43), Expect = 4.0
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -2

Query: 449 FFPVNIIYLCTK 414
           FF VN++Y+C +
Sbjct: 278 FFIVNVLYICNQ 289


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 21.4 bits (43), Expect = 4.0
 Identities = 13/52 (25%), Positives = 22/52 (42%)
 Frame = +2

Query: 263 YCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +C +  AL+ CS+  F     +  + LA  + L  S        S Y  ++W
Sbjct: 43  FCTFVAALVYCSVTFFALSELL--TDLATSILLKVSSLLIGFCASIYVGTVW 92


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,272
Number of Sequences: 336
Number of extensions: 1952
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10195961
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)