BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30074.Seq (450 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch... 26 3.1 SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr 3||... 24 9.4 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 24 9.4 >SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1480 Score = 25.8 bits (54), Expect = 3.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 290 VCSLLHFCY-YIFISTSSLAVCLDLNNSHYRRPLFISTYYA 409 VC +H + YI++ SS A LDL + L S YA Sbjct: 51 VCCFIHNVFPYIYVEYSSFAETLDLEVPDFLSQLQTSINYA 91 >SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr 3|||Manual Length = 265 Score = 24.2 bits (50), Expect = 9.4 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 196 ILYWEGIFIYQEDLVFNLKYCSLF*S**FKLGNLTTVFDNDSLR 65 IL W I+ L N KYCSL+ LG ++ N +L+ Sbjct: 172 ILDWSYTEIWDLLLETNTKYCSLYDRGYTSLGGVSDTSPNPALK 215 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 24.2 bits (50), Expect = 9.4 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +2 Query: 317 YIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYI 424 +IF S L N HY P F+ Y S+ ++ Sbjct: 316 WIFDSMDGAPRILRSRNGHYEPPSFVKFYGKSVHFL 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,643,958 Number of Sequences: 5004 Number of extensions: 28388 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -