BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30074.Seq (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 31 0.58 SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) 31 0.58 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_43689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 30 1.0 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 28 3.1 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 27 7.2 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 27 7.2 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 9.5 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 27 9.5 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 27 9.5 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 27 9.5 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 254 GTGYCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406 G G C+Y S +++C + S AVC+++ H RP F+S Y Sbjct: 523 GGGVCLYLR-----SSINYCIRNLVPDSVEAVCVEITKPH-SRPFFVSIIY 567 >SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) Length = 670 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 254 GTGYCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406 G G C+Y S +++C + S AVC+++ H RP F+S Y Sbjct: 404 GGGVCLYLR-----SSINYCIRNLVPDSVEAVCVEITKPH-SRPFFVSIIY 448 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 112 FKLGNLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8 F+ G+LTT +R L+ C+PG PL LERP Sbjct: 7 FRCGHLTTNAAT-RVRFPLISNSCSPGDPLVLERP 40 >SB_43689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 269 IYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYR-RPLFISTYYAS 412 + F A+++C +LH IF L VC++L +Y+ R +F+ Y S Sbjct: 137 VEFKAMIICLILHLLLLIF----ELLVCINLGGRNYQWRIMFMPLYVLS 181 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.77 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8 N + R LV C+PG PL LERP Sbjct: 17 NPNTRAHLVSNSCSPGDPLVLERP 40 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 0.77 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8 ++ D+L L C+PG PL LERP Sbjct: 6 YETDALPTALTSNSCSPGDPLVLERP 31 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 0.77 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -3 Query: 103 GNLTTVFDNDSLRGL---LVPXXCTPGXPLXLERP 8 GNL VF D +R L L+ C+PG PL LERP Sbjct: 20 GNLDDVFVRD-IRILFLDLISNSCSPGDPLVLERP 53 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 0.77 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 100 NLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8 N+ T + S R LV C+PG PL LERP Sbjct: 12 NIPTRYAILSPRARLVSNSCSPGDPLVLERP 42 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 29.9 bits (64), Expect = 1.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 91 TVFDNDSLRGLLVPXXCTPGXPLXLERP 8 +++ ++ ++ L C+PG PL LERP Sbjct: 85 SIYGHEDIKRALASNSCSPGDPLVLERP 112 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 67 RGLLVPXXCTPGXPLXLERP 8 R +LV C+PG PL LERP Sbjct: 23 RPMLVSNSCSPGDPLVLERP 42 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 LLV C+PG PL LERP Sbjct: 16 LLVSNSCSPGDPLVLERP 33 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 73 SLRGLLVPXXCTPGXPLXLERP 8 +L L++ C+PG PL LERP Sbjct: 21 TLGSLIISNSCSPGDPLVLERP 42 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8 +++LR +LV C+PG PL LERP Sbjct: 3 HNTLR-ILVSNSCSPGDPLVLERP 25 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8 N +RG C+PG PL LERP Sbjct: 11 NPEVRGSKPSNSCSPGDPLVLERP 34 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 9 GRSRXSGXPGVQXXGTRRPLRESLSKTV 92 GRSR SG PG+Q +R R L + + Sbjct: 10 GRSRTSGSPGLQEFDNKRAARRDLDQFI 37 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 76 DSLRG-LLVPXXCTPGXPLXLERP 8 D +G LL C+PG PL LERP Sbjct: 71 DECKGILLTSNSCSPGDPLVLERP 94 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 88 VFDNDSLRGLLVPXXCTPGXPLXLERP 8 VF ++S V C+PG PL LERP Sbjct: 21 VFYSNSTPHFRVSNSCSPGDPLVLERP 47 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +LV C+PG PL LERP Sbjct: 4 MLVSNSCSPGDPLVLERP 21 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +LV C+PG PL LERP Sbjct: 1 MLVSNSCSPGDPLVLERP 18 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 94 TTVFDNDSLRGLLVPXX-CTPGXPLXLERP 8 T + N LRG+ C+PG PL LERP Sbjct: 7 TLISANIRLRGICAASNSCSPGDPLVLERP 36 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 67 RGLLVPXXCTPGXPLXLERP 8 RG+ C+PG PL LERP Sbjct: 30 RGVHASNSCSPGDPLVLERP 49 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 76 DSLRGLLVPXXCTPGXPLXLERP 8 D+ LL C+PG PL LERP Sbjct: 82 DASNLLLTSNSCSPGDPLVLERP 104 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 73 SLRGLLVPXXCTPGXPLXLERP 8 +L L+ C+PG PL LERP Sbjct: 2 ALSSFLLSNSCSPGDPLVLERP 23 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 L L+ C+PG PL LERP Sbjct: 13 LISFLISNSCSPGDPLVLERP 33 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L V C+PG PL LERP Sbjct: 8 LFVSNSCSPGDPLVLERP 25 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 LV C+PG PL LERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 L+ L+ C+PG PL LERP Sbjct: 16 LKLLITSNSCSPGDPLVLERP 36 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 67 RGLLVPXXCTPGXPLXLERP 8 R L + C+PG PL LERP Sbjct: 4 RRLFLSNSCSPGDPLVLERP 23 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 64 GLLVPXX-CTPGXPLXLERP 8 GL +P C+PG PL LERP Sbjct: 4 GLFLPSNSCSPGDPLVLERP 23 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 64 GLLVPXXCTPGXPLXLERP 8 G V C+PG PL LERP Sbjct: 31 GFKVSNSCSPGDPLVLERP 49 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 LL C+PG PL LERP Sbjct: 4 LLASNSCSPGDPLVLERP 21 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 +R L+ C+PG PL LERP Sbjct: 4 VRIYLISNSCSPGDPLVLERP 24 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 88 VFDNDSLRGLLVPXXCTPGXPLXLERP 8 V D D+L C+PG PL LERP Sbjct: 31 VLDLDALDTTQGSNSCSPGDPLVLERP 57 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8 F+N R V C+PG PL LERP Sbjct: 5 FENRIGRCWQVSNSCSPGDPLVLERP 30 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 LR L C+PG PL LERP Sbjct: 31 LRKLCESNSCSPGDPLVLERP 51 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 109 KLGNLTTVFDNDSLR-GLLVPXXCTPGXPLXLERP 8 KL + V D L G + C+PG PL LERP Sbjct: 4 KLTEMCAVRDTSILSAGRSLSNSCSPGDPLVLERP 38 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 67 RGLLVPXXCTPGXPLXLERP 8 + L + C+PG PL LERP Sbjct: 97 KSLKISNSCSPGDPLVLERP 116 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 97 LTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8 +T + + G C+PG PL LERP Sbjct: 465 VTRLLQGEIASGQTTSNSCSPGDPLVLERP 494 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 73 SLRGLLVPXXCTPGXPLXLERP 8 S + + C+PG PL LERP Sbjct: 41 SKKNFFISNSCSPGDPLVLERP 62 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +++ C+PG PL LERP Sbjct: 13 IIISNSCSPGDPLVLERP 30 >SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -3 Query: 94 TTVFDNDSLRGLLVPXXCTPGXPLXLERP 8 T FDN SLR L + PG PL LERP Sbjct: 13 TRGFDNKSLR-LKMNYAEIPGDPLVLERP 40 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 82 DNDSLRGLL-VPXXCTPGXPLXLERP 8 +N SL+ + C+PG PL LERP Sbjct: 22 ENSSLKPTFSISNSCSPGDPLVLERP 47 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L V C+PG PL LERP Sbjct: 2 LYVSNSCSPGDPLVLERP 19 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +L+ C+PG PL LERP Sbjct: 5 ILLSNSCSPGDPLVLERP 22 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 112 FKLGNLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8 FK+ N + + L C+PG PL LERP Sbjct: 208 FKVSNTPAAEQRNYTQLLESSNSCSPGDPLVLERP 242 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 70 LISNSCSPGDPLVLERP 86 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 34 LISNSCSPGDPLVLERP 50 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8 F + + +V C+PG PL LERP Sbjct: 4 FTDTLISANIVSNSCSPGDPLVLERP 29 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 21 LISNSCSPGDPLVLERP 37 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 16 LISNSCSPGDPLVLERP 32 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 31 LISNSCSPGDPLVLERP 47 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -3 Query: 82 DNDSLRGLLVPXX---CTPGXPLXLERP 8 DN + LVP C+PG PL LERP Sbjct: 14 DNGTNGASLVPRPSNSCSPGDPLVLERP 41 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 347 IVSNSCSPGDPLVLERP 363 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 LL C+PG PL LERP Sbjct: 24 LLPSNSCSPGDPLVLERP 41 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L V C+PG PL LERP Sbjct: 38 LRVSNSCSPGDPLVLERP 55 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +++ C+PG PL LERP Sbjct: 13 IVISNSCSPGDPLVLERP 30 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 +R + C+PG PL LERP Sbjct: 3 MRVIFTSNSCSPGDPLVLERP 23 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 77 IVSNSCSPGDPLVLERP 93 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 64 GLLVPXXCTPGXPLXLERP 8 G+ C+PG PL LERP Sbjct: 7 GIKTSNSCSPGDPLVLERP 25 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8 F + + ++ C+PG PL LERP Sbjct: 4 FTDTLISANIISNSCSPGDPLVLERP 29 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 ++V C+PG PL LERP Sbjct: 6 VVVSNSCSPGDPLVLERP 23 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 11 MVSNSCSPGDPLVLERP 27 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 70 LRGLLVPXXCTPGXPLXLERP 8 +R L C+PG PL LERP Sbjct: 24 IRSLQRSNSCSPGDPLVLERP 44 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 97 LTTVFDND-SLRGLLVPXXCTPGXPLXLERP 8 LT V N +L ++ C+PG PL LERP Sbjct: 51 LTLVITNLLALTVFMLSNSCSPGDPLVLERP 81 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +++ C+PG PL LERP Sbjct: 4 VIISNSCSPGDPLVLERP 21 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 64 GLLVPXXCTPGXPLXLERP 8 G+ C+PG PL LERP Sbjct: 8 GIRTSNSCSPGDPLVLERP 26 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L V C+PG PL LERP Sbjct: 16 LKVSNSCSPGDPLVLERP 33 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 311 CYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406 C+ + ++T + CL L N HY P S +Y Sbjct: 10 CFSVALATDA-TYCLSLPNGHYHDPRNCSRFY 40 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 85 IVSNSCSPGDPLVLERP 101 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +L C+PG PL LERP Sbjct: 10 MLASNSCSPGDPLVLERP 27 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 82 DN-DSLRGLLVPXXCTPGXPLXLERP 8 DN + R L C+PG PL LERP Sbjct: 5 DNLEGSRRLQTSNSCSPGDPLVLERP 30 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 6 IVSNSCSPGDPLVLERP 22 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 58 LVPXXCTPGXPLXLERP 8 +V C+PG PL LERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 LL C+PG PL LERP Sbjct: 21 LLPSNSCSPGDPLVLERP 38 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 82 DNDSLRGLLVPXXCTPGXPLXLERP 8 D + ++ + + C+PG PL LERP Sbjct: 59 DLNIIQKIKISNSCSPGDPLVLERP 83 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8 F + + ++ C+PG PL LERP Sbjct: 4 FTDTLISANIISNSCSPGDPLVLERP 29 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L V C+PG PL LERP Sbjct: 7 LRVSNSCSPGDPLVLERP 24 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 +++ C+PG PL LERP Sbjct: 24 IVISNSCSPGDPLVLERP 41 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 144 LITSNSCSPGDPLVLERP 161 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -3 Query: 79 NDSLRGLL-VPXXCTPGXPLXLERP 8 N S + LL + C+PG PL LERP Sbjct: 3 NQSKQCLLEISNSCSPGDPLVLERP 27 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 61 LLVPXXCTPGXPLXLERP 8 L+ C+PG PL LERP Sbjct: 5 LITSNSCSPGDPLVLERP 22 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,957,648 Number of Sequences: 59808 Number of extensions: 200405 Number of successful extensions: 2441 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 2414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2441 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -