BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30074.Seq (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 1.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 1.5 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 23 1.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 1.5 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 22 2.7 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 22 2.7 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430 LLV +L F Y + + L + ++ R P+F S Y + Y +K Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 430 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430 LLV +L F Y + + L + ++ R P+F S Y + Y +K Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 430 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430 LLV +L F Y + + L + ++ R P+F S Y + Y +K Sbjct: 8 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 56 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 359 LNNSHYRRPLFISTYYASIWYINK*Y 436 L + HYR+P +S Y+S Y+N Y Sbjct: 361 LQHLHYRQPPTLSESYSS--YVNSMY 384 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 311 KNATMNILIMHGNKCNN 261 KN + IL HG +CN+ Sbjct: 89 KNPKLGILGTHGRQCND 105 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 311 KNATMNILIMHGNKCNN 261 KN + IL HG +CN+ Sbjct: 90 KNPKLGILGTHGRQCND 106 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,362 Number of Sequences: 438 Number of extensions: 2113 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -