BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30059.Seq (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 3.6 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = +1 Query: 445 AAQSFRYRYQYRFPNWIPFHHAKSSFGTSA*LCTYLYTLQGAWSVRLKQWA--AGRAHTI 618 AAQ YR YR P +P F A + T +Q A S W +G+A Sbjct: 9 AAQRDAYRTSYRGPPKVPNERKARPFSAKARISTEKVDIQTAESPSRPPWRPFSGQASLS 68 Query: 619 N-S*PTKEGVYT 651 S P+KE ++T Sbjct: 69 RVSAPSKETIFT 80 >SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 310 LATWEVDTQSXCLSKSPHMTRLS 242 + TW VD S C S SPH L+ Sbjct: 88 IRTWNVDVNSLCCSWSPHAVWLA 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,685,303 Number of Sequences: 59808 Number of extensions: 412846 Number of successful extensions: 781 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -