BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30018.Seq (825 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine re... 28 7.1 Z68882-16|CAE17745.1| 118|Caenorhabditis elegans Hypothetical p... 28 9.3 AF106576-4|AAC78176.1| 473|Caenorhabditis elegans Hypothetical ... 28 9.3 >U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine receptor family (seegbr) protein 3 protein. Length = 438 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 343 YSCTKDSRVYEWNIEDGSVKQTYNISIENN 432 YSCT +NI + ++ YNIS E N Sbjct: 370 YSCTSKCNSVRYNINNNDDEELYNISGETN 399 >Z68882-16|CAE17745.1| 118|Caenorhabditis elegans Hypothetical protein C47E12.13 protein. Length = 118 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 318 QGGHFSAKMFGGHPNIYYFRLIIEYINSLPFV 223 +G F K+FG H N+Y F + Y+ LPF+ Sbjct: 73 EGSKFFRKVFG-HENVYRFHFLPRYL--LPFI 101 >AF106576-4|AAC78176.1| 473|Caenorhabditis elegans Hypothetical protein W07E6.2 protein. Length = 473 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 298 SAKVTALDWSRKYGLYSCTKDSRVYEWNIEDG 393 +A VT L W + +YS ++D V W +DG Sbjct: 237 TASVTCLRWGGEGLIYSGSQDRTVKMWRADDG 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,658,845 Number of Sequences: 27780 Number of extensions: 337596 Number of successful extensions: 701 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2040452812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -