BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0768.Seq (284 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.037 SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) 27 1.8 SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_7430| Best HMM Match : LIM (HMM E-Value=4.7) 27 1.8 SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 27 3.2 SB_14514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) 27 3.2 SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) 27 3.2 SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) 27 3.2 SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) 26 4.2 SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) 26 4.2 SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) 26 4.2 SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_55762| Best HMM Match : LIM (HMM E-Value=7) 26 4.2 SB_53009| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) 26 4.2 SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_45035| Best HMM Match : DUF1287 (HMM E-Value=5.1) 26 4.2 SB_44046| Best HMM Match : P19Arf_N (HMM E-Value=5.5) 26 4.2 SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) 26 4.2 SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) 26 4.2 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 26 4.2 SB_35739| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_34879| Best HMM Match : DUF1287 (HMM E-Value=1.5) 26 4.2 SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) 26 4.2 SB_32373| Best HMM Match : Cys_knot (HMM E-Value=8.9) 26 4.2 SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) 26 4.2 SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_29795| Best HMM Match : ResIII (HMM E-Value=0.16) 26 4.2 SB_29629| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_29109| Best HMM Match : C1_1 (HMM E-Value=3.6) 26 4.2 SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) 26 4.2 SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 26 4.2 SB_17225| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_16594| Best HMM Match : DUF1265 (HMM E-Value=2.6) 26 4.2 SB_14412| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) 26 4.2 SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_5592| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) 26 4.2 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_1473| Best HMM Match : DUF551 (HMM E-Value=1.6) 26 4.2 SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) 26 4.2 SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_59009| Best HMM Match : DEAD (HMM E-Value=0.87) 26 4.2 SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 26 4.2 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 26 4.2 SB_49506| Best HMM Match : LIM (HMM E-Value=7) 26 4.2 SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_40444| Best HMM Match : LIM (HMM E-Value=3.4) 26 4.2 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 26 4.2 SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) 26 4.2 SB_30957| Best HMM Match : DEAD (HMM E-Value=4.3) 26 4.2 SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_26900| Best HMM Match : LIM (HMM E-Value=0.63) 26 4.2 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 26 4.2 SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) 26 4.2 SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) 26 4.2 SB_16039| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_15365| Best HMM Match : U79_P34 (HMM E-Value=1.8) 26 4.2 SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) 26 4.2 SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 26 4.2 SB_3895| Best HMM Match : ResIII (HMM E-Value=1.1) 26 4.2 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) 26 4.2 SB_2283| Best HMM Match : LIM (HMM E-Value=1.4) 26 4.2 SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) 26 4.2 SB_814| Best HMM Match : LIM (HMM E-Value=8.3) 26 4.2 SB_49765| Best HMM Match : EGF (HMM E-Value=0) 26 5.6 SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 26 5.6 SB_25765| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) 26 5.6 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 26 5.6 SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_19858| Best HMM Match : DEAD (HMM E-Value=0.61) 26 5.6 SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) 26 5.6 SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) 26 5.6 SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) 26 5.6 SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) 25 7.4 SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) 25 7.4 SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) 25 7.4 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) 25 7.4 SB_22252| Best HMM Match : C1_1 (HMM E-Value=2.6) 25 7.4 SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_11577| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) 25 7.4 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) 25 7.4 SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) 25 7.4 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 25 7.4 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 25 7.4 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 25 7.4 SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) 25 7.4 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 25 7.4 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 25 7.4 SB_24617| Best HMM Match : C1_1 (HMM E-Value=2.6) 25 7.4 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 25 7.4 SB_14604| Best HMM Match : PT (HMM E-Value=5.1) 25 7.4 SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) 25 7.4 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 25 7.4 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 25 7.4 SB_53991| Best HMM Match : LIM (HMM E-Value=1.3) 25 9.8 SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) 25 9.8 SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) 25 9.8 SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) 25 9.8 SB_12589| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.1 bits (72), Expect = 0.037 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 135 GXIDGLSPGRHGLHXYEXGDLSQGCNS 55 G I+GL G HG H + GD + GC S Sbjct: 32 GTIEGLKAGNHGFHIHVYGDNTNGCVS 58 >SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) Length = 373 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G RP+ST DC S P SRL Sbjct: 92 CEDCG-RPYSTCDCGSTAPSSRL 113 >SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +3 Query: 165 CLXPDHXPGSYCXTIGPRPWSTADCVSPKPGSRL 266 CL D+ C G +P+ST DC S P SRL Sbjct: 348 CLESDYR--CLCEDCG-KPYSTCDCGSAAPSSRL 378 >SB_7430| Best HMM Match : LIM (HMM E-Value=4.7) Length = 130 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G RP+ST DC S P SRL Sbjct: 21 CEDCG-RPYSTCDCGSTAPSSRL 42 >SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 RP+ST DC S P SRL Sbjct: 655 RPYSTCDCGSAAPSSRL 671 >SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 925 CEDCG-KPYSTCDCCSAAPSSRL 946 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = +3 Query: 138 QPPGGPSAVCLXPDHXPGSYCXTIGPRPWSTADCVSPKPGSRLVLPV 278 +PP P V + P P P P +C P PG + L + Sbjct: 553 EPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPGDEMALRI 599 >SB_14514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 149 CEDCG-KPYSTCDCGSASPSSRL 170 >SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) Length = 595 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 307 CENCG-KPYSTCDCGSAAPSSRL 328 >SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) Length = 1056 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 796 CEDFG-KPYSTCDCGSAAPSSRL 817 >SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) Length = 789 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 484 CENCG-KPYSTCDCGSAAPSSRL 505 >SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1009 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 788 CEDCG-KPYSTCDCGSASPSSRL 809 >SB_58867| Best HMM Match : Bombesin (HMM E-Value=2.2) Length = 423 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 394 CEDCG-KPYSTCDCGSAAPSSRL 415 >SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) Length = 1037 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 777 CEDCG-KPYSTCDCGSAAPSSRL 798 >SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) Length = 434 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 288 CEDCG-KPYSTCDCGSAAPSSRL 309 >SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 467 CEDCG-KPYSTCDCGSAAPSSRL 488 >SB_55762| Best HMM Match : LIM (HMM E-Value=7) Length = 208 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_53009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 149 CEDCG-KPYSTCDCGSAAPSSRL 170 >SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 656 CEDCG-KPYSTCDCGSAAPSSRL 677 >SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 211 CEDCG-KPYSTCDCGSAAPSSRL 232 >SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) Length = 782 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 565 CEDCG-KPYSTCDCGSAAPSSRL 586 >SB_46403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 620 CEDCG-KPYSTCDCGSAAPSSRL 641 >SB_45035| Best HMM Match : DUF1287 (HMM E-Value=5.1) Length = 263 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_44046| Best HMM Match : P19Arf_N (HMM E-Value=5.5) Length = 337 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 75 CKDCG-KPYSTCDCGSAAPSSRL 96 >SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) Length = 908 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 519 CEDCG-KPYSTCDCGSAAPSSRL 540 >SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 845 CEDCG-KPYSTCDCGSAAPSSRL 866 >SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) Length = 439 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 221 CEDCG-KPYSTCDCGSAAPSSRL 242 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 927 CEDCG-KPYSTCDCGSAAPSSRL 948 >SB_35739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 531 CEDCG-KPYSTCDCGSAAPSSRL 552 >SB_34879| Best HMM Match : DUF1287 (HMM E-Value=1.5) Length = 840 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 629 CEDCG-KPYSTCDCGSAAPSSRL 650 >SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 1066 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 730 CEDCG-KPYSTCDCGSAAPSSRL 751 >SB_32373| Best HMM Match : Cys_knot (HMM E-Value=8.9) Length = 349 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 145 CEDCG-KPYSTCDCGSAAPSSRL 166 >SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 903 CEDCG-KPYSTCDCGSAAPSSRL 924 >SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) Length = 488 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 267 CEDCG-KPYSTCDCGSAAPSSRL 288 >SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 680 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 399 CEDCG-KPYSTCDCGSAAPSSRL 420 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 17 RRRADXHYNXPLMELQP*LKSPXSYXWSPCLPGLSPSMXPSA 142 R R+ HY L+E +P ++ W+P P L+P PSA Sbjct: 60 RNRSTDHY-FDLVEKY----NPQTHQWTPVAPMLTPRAWPSA 96 >SB_29795| Best HMM Match : ResIII (HMM E-Value=0.16) Length = 818 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 543 CEDCG-KPYSTCDCGSAAPSSRL 564 >SB_29629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 92 CEDCG-KPYSTCDCGSAAPSSRL 113 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 879 CEDCG-KPYSTCDCGSAAPSSRL 900 >SB_29109| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 269 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 57 CEDCG-KPYSTCDCGSAAPSSRL 78 >SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) Length = 1097 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 824 CEDCG-KPYSTCDCGSAAPSSRL 845 >SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 448 CEDCG-KPYSTCDCGSAAPSSRL 469 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 915 CEDCG-KPYSTCDCGSAAPSSRL 936 >SB_17225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 66 CEDCG-KPYSTCDCGSAAPSSRL 87 >SB_16594| Best HMM Match : DUF1265 (HMM E-Value=2.6) Length = 734 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 422 CEDCG-KPYSTCDCGSAAPSSRL 443 >SB_14412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 705 CEDCG-KPYSTCDCGSTAPSSRL 726 >SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 967 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 631 CEDCG-KPYSTCDCGSAAPSSRL 652 >SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 629 CEDCG-KPYSTCDCGSAAPSSRL 650 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 3010 CEDCG-KPYSTCDCGSAAPSSRL 3031 >SB_5592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 858 CEDCG-KPYSTCDCGSAAPSSRL 879 >SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) Length = 1017 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 850 CEDCG-KPYSTCDCGSAAPSSRL 871 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 710 CEDCG-KPYSTCDCGSAAPSSRL 731 >SB_1473| Best HMM Match : DUF551 (HMM E-Value=1.6) Length = 917 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 165 CLXPDHXPGSYCXTIGPRPWSTADCVSPKPGSRL 266 CL D+ C G +P+ST DC + P SRL Sbjct: 666 CLESDYR--CLCKDCG-KPYSTCDCGTAAPSSRL 696 >SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) Length = 918 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 754 CEDCG-KPYSTCDCGSAAPSSRL 775 >SB_59743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 1094 CEDCG-KPYSTCDCGSAAPSSRL 1115 >SB_59009| Best HMM Match : DEAD (HMM E-Value=0.87) Length = 957 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 657 CEDCG-KPYSTCDCGSAAPSSRL 678 >SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 724 CEDCG-KPYSTCDCGSAAPSSRL 745 >SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 716 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 304 CEDCG-KPYSTCDCDSAAPSSRL 325 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 892 CEDCG-KPYSTCDCGSAAPSSRL 913 >SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 394 CEDCG-KPYSTCDCGSAAPSSRL 415 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 660 CEDCG-KPYSTCDCGSAAPSSRL 681 >SB_49506| Best HMM Match : LIM (HMM E-Value=7) Length = 222 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 516 CEDCG-KPYSTCDCGSAAPSSRL 537 >SB_40444| Best HMM Match : LIM (HMM E-Value=3.4) Length = 304 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 844 CEDCG-KPYSTCDCGSAAPSSRL 865 >SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 120 CEDCG-KPYSTCDCDSAAPSSRL 141 >SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) Length = 385 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 318 CEDCG-KPYSTCDCGSAAPSSRL 339 >SB_30957| Best HMM Match : DEAD (HMM E-Value=4.3) Length = 314 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 191 CEDCG-KPYSTCDCGSAAPSSRL 212 >SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 791 CEDCG-KPYSTCDCGSAAPSSRL 812 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 938 CEDCG-KPYSTCDCGSAAPSSRL 959 >SB_26900| Best HMM Match : LIM (HMM E-Value=0.63) Length = 333 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 517 CEDCG-KPYSTCDCGSAAPSSRL 538 >SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) Length = 942 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 815 CEDCG-KPYSTCDCGSAAPSSRL 836 >SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) Length = 355 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 309 CEDCG-KPYSTCDCGSAAPSSRL 330 >SB_16039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 123 CEDCG-KPYSTCDCGSAAPSSRL 144 >SB_15365| Best HMM Match : U79_P34 (HMM E-Value=1.8) Length = 992 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 837 CEDCG-KPYSTCDCGSAAPSSRL 858 >SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1118 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 989 CEDCG-KPYSTCDCGSAAPSSRL 1010 >SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 288 CEDCG-KPYSTCDCGSAAPSSRL 309 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 801 CEDCG-KPYSTCDCGSAAPSSRL 822 >SB_3895| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1115 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 864 CEDCG-KPYSTCDCGSAAPSSRL 885 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 821 CEDCG-KPYSTCDCGSAAPSSRL 842 >SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) Length = 928 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 706 CEDCG-KPYSTCDCGSAAPSSRL 727 >SB_2283| Best HMM Match : LIM (HMM E-Value=1.4) Length = 336 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 132 CEDCG-KPYSTCDCGSAAPSSRL 153 >SB_1328| Best HMM Match : PHZA_PHZB (HMM E-Value=3.4) Length = 636 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 493 CEDCG-KPYSTCDCGSAAPSSRL 514 >SB_814| Best HMM Match : LIM (HMM E-Value=8.3) Length = 277 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTCDCGSAAPSSRL 42 >SB_49765| Best HMM Match : EGF (HMM E-Value=0) Length = 508 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/36 (25%), Positives = 15/36 (41%) Frame = +3 Query: 132 CRQPPGGPSAVCLXPDHXPGSYCXTIGPRPWSTADC 239 C G + C G +C T+ P+P ++ C Sbjct: 173 CNNTQDGKNYTCTCSPGYTGRHCDTVIPKPCDSSPC 208 >SB_48331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 310 KPYSTCDCGSAAPSSRL 326 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 1174 KPYSTCDCGSAAPSSRL 1190 >SB_25765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 137 KPYSTCDCGSAAPSSRL 153 >SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 534 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 501 KPYSTCDCGSAAPSSRL 517 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 677 KPYSTCDCGSAAPSSRL 693 >SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 562 KPYSTCDCGSAAPSSRL 578 >SB_19858| Best HMM Match : DEAD (HMM E-Value=0.61) Length = 257 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 156 KPYSTCDCGSATPSSRL 172 >SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 242 NTIGRRPWSRTNRXAIRSWXVVRXQTDGRGPAWW 141 N G R WS N R W V D GP W Sbjct: 1394 NADGSRQWSPVNADGSRQWSPV---NDADGPRQW 1424 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +3 Query: 174 PDHXPGSYCXTIG--PRPW 224 P H PG + T+G P+PW Sbjct: 194 PSHNPGDHATTLGTKPQPW 212 Score = 25.0 bits (52), Expect = 9.8 Identities = 9/19 (47%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Frame = +3 Query: 174 PDHXPGSYCXTIG--PRPW 224 P H PG T+G P+PW Sbjct: 760 PSHNPGDQATTLGTKPKPW 778 >SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) Length = 743 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 231 KPYSTCDCGSAAPSSRL 247 >SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 596 KPYSTCDCGSAAPSSRL 612 >SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 921 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 740 KPYSTCDCGSAAPSSRL 756 >SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) Length = 895 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 442 KPYSTCDCGSAAPSSRL 458 >SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) Length = 906 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 216 RPWSTADCVSPKPGSRL 266 +P+ST DC S P SRL Sbjct: 725 KPYSTCDCGSAAPSSRL 741 >SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 428 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 344 CEDCG-NPYSTCDCGSAAPSSRL 365 >SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) Length = 521 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 279 CEDCG-NPYSTCDCGSAAPSSRL 300 >SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) Length = 396 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 140 CEDCG-NPYSTCDCGSAAPSSRL 161 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 596 CEDCG-NPYSTCDCGSAAPSSRL 617 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 901 CEDCG-NPYSTCDCGSAAPSSRL 922 >SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 751 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 439 CEDCG-NPYSTCDCGSAAPSSRL 460 >SB_22252| Best HMM Match : C1_1 (HMM E-Value=2.6) Length = 333 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTFDCGSAAPSSRL 42 >SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 21 CEDCG-NPYSTCDCGSAAPSSRL 42 >SB_11577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 217 DHGRRPIVFPQNLDHGWYSPST 282 +H R IV+P+ +DH Y+ +T Sbjct: 65 EHSRSEIVYPERVDHLRYARAT 86 >SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 624 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 344 CEDCG-NPYSTCDCGSAAPSSRL 365 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 848 CEDCG-NPYSTCDCGSAAPSSRL 869 >SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) Length = 532 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 232 CEDCG-NPYSTCDCGSAAPSSRL 253 >SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) Length = 314 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 286 CEDCG-KPYSTFDCGSAAPSSRL 307 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 1078 CEDCG-NPYSTCDCGSAAPSSRL 1099 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 957 CEDCG-NPYSTCDCGSATPSSRL 978 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 924 CEDCG-NPYSTCDCGSATPSSRL 945 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 877 CEDCG-NPYSTCDCGSAAPSSRL 898 >SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) Length = 992 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 790 CEDCG-NPYSTCDCGSAAPSSRL 811 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 442 CEDCG-NPYSTCDCGSAAPSSRL 463 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 864 CEDCG-NPYSTCDCGSATPSSRL 885 >SB_24617| Best HMM Match : C1_1 (HMM E-Value=2.6) Length = 333 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P+ST DC S P SRL Sbjct: 21 CEDCG-KPYSTFDCGSAAPSSRL 42 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 879 CEDCG-NPYSTCDCGSAAPSSRL 900 >SB_14604| Best HMM Match : PT (HMM E-Value=5.1) Length = 344 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 168 LXPDHXPGSYCXTIGPR--PWSTAD 236 L P H PG T+G + PW +D Sbjct: 51 LGPSHNPGDQATTLGTKRQPWGPSD 75 >SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) Length = 1105 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 849 CEDCG-NPYSTCDCGSAAPSSRL 870 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 1033 CEDCG-NPYSTCDCGSAAPSSRL 1054 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G P+ST DC S P SRL Sbjct: 901 CEDCG-NPYSTCDCGSAAPSSRL 922 >SB_53991| Best HMM Match : LIM (HMM E-Value=1.3) Length = 333 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 219 PWSTADCVSPKPGSRL 266 P+ST DC S P SRL Sbjct: 27 PYSTCDCGSAAPSSRL 42 >SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) Length = 1127 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 219 PWSTADCVSPKPGSRL 266 P+ST DC S P SRL Sbjct: 716 PYSTCDCGSAAPSSRL 731 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 219 PWSTADCVSPKPGSRL 266 P+ST DC S P SRL Sbjct: 829 PYSTCDCGSAAPSSRL 844 >SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) Length = 344 Score = 25.0 bits (52), Expect = 9.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 198 CXTIGPRPWSTADCVSPKPGSRL 266 C G +P ST DC S P SRL Sbjct: 149 CEDFG-KPHSTCDCGSAAPSSRL 170 >SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 1248 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 219 PWSTADCVSPKPGSRL 266 P+ST DC S P SRL Sbjct: 942 PYSTCDCGSAAPSSRL 957 >SB_12589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1255 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 219 PWSTADCVSPKPGSRL 266 P+ST DC S P SRL Sbjct: 1016 PYSTCDCGSAAPSSRL 1031 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,235,339 Number of Sequences: 59808 Number of extensions: 184803 Number of successful extensions: 548 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 303237528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -