BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0761.Seq (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0819 - 21529913-21530064,21531016-21531082,21531284-215313... 31 1.0 01_06_1027 + 33912773-33912816,33913245-33913401,33913492-339135... 31 1.3 02_04_0109 + 19812544-19814474,19814574-19814607 30 2.3 09_03_0218 + 13539481-13540082,13540171-13540276,13540645-135409... 29 4.1 04_03_1028 - 21827961-21827972,21828018-21828112,21828286-218283... 29 4.1 11_06_0764 + 27108979-27110018,27110176-27112270 28 9.4 >08_02_0819 - 21529913-21530064,21531016-21531082,21531284-21531373, 21531506-21531622,21532026-21532145,21532313-21533581 Length = 604 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 306 RSKGNVEAVIVDPVEPPSKRTRAKTKKNSEVRSRFHGRPRPAEVA 440 ++ G V+ + P+ PP K A + EV SRF PA A Sbjct: 10 KAAGTVDCALRQPLVPPEKNIAAPAGRRREVASRFKSGGTPAPQA 54 >01_06_1027 + 33912773-33912816,33913245-33913401,33913492-33913589, 33913680-33913775,33914422-33914681,33914778-33915088, 33915154-33915297,33915452-33915589,33915674-33915721, 33916328-33916408,33916705-33916864,33917411-33917532 Length = 552 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 348 EPPSKRTRAKTKKNSEVRSRFHGRPRPAEVAQKELGILGVEIPAE 482 E PSKR+RAK K +E S + + V +K+L + G + E Sbjct: 183 ETPSKRSRAKNKGTAEESSGANVKQSKTSVQKKKLVVQGASVDHE 227 >02_04_0109 + 19812544-19814474,19814574-19814607 Length = 654 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 368 SCEDQKELRSTQQISRTPETGRGRSKRARNIRGRNTSRGRANRSRST 508 S ED++ R ++ I +TP+ R RS R++ RG + S R+ S ST Sbjct: 353 SREDKRHTRCSESIPQTPKESRKRS-RSKRSRGSSLSSDRST-SHST 397 >09_03_0218 + 13539481-13540082,13540171-13540276,13540645-13540960, 13541187-13541263,13541269-13541895,13542783-13543112, 13543442-13543747,13543824-13543896,13544004-13544089, 13544219-13544396,13545311-13545756 Length = 1048 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 428 GRGRSKRARNIRGRNTSRGRA-NRSRS 505 GRGR +R +RGR RGR R RS Sbjct: 52 GRGRGRRGGAVRGRGRGRGRCRGRGRS 78 >04_03_1028 - 21827961-21827972,21828018-21828112,21828286-21828361, 21828921-21829037,21829532-21829621,21830011-21830056, 21831407-21831502,21831599-21832008 Length = 313 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 392 RSTQQISRTPETGRGRSKRARNIRGRNTS 478 RS++ SR+P GR RS+ RGR+ S Sbjct: 62 RSSRSRSRSPRRGRSRSRSRSRSRGRSAS 90 >11_06_0764 + 27108979-27110018,27110176-27112270 Length = 1044 Score = 27.9 bits (59), Expect = 9.4 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 353 AIKKNSCEDQKELRSTQQISRTPETGRG--RSKRARNIRGRNTSRGRANRSRSTVEVGA- 523 A+ +N ED+ Q+S+ E G S R N R S ++R +T E G Sbjct: 241 AVSQNYDEDEVLRSILNQVSKQEEAGGSTESSSRDENTREPQGSSSTSSREENTAESGTK 300 Query: 524 TLIEKLK 544 ++ KLK Sbjct: 301 RMLNKLK 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,281,747 Number of Sequences: 37544 Number of extensions: 361280 Number of successful extensions: 1037 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -