BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0741.Seq (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.4 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 2.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 4.1 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 428 MRLLLSWNICDAPGSGNYCL 369 +R+ L W C P + YCL Sbjct: 130 LRIDLPWRTCGNPWNTRYCL 149 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 428 MRLLLSWNICDAPGSGNYCL 369 +R+ L W C P + YCL Sbjct: 183 LRIDLPWRTCGNPWNTRYCL 202 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 187 ASCNAFCTCGISSSERFRPNLKKYPLSC 270 AS + FC ++FR + K PL C Sbjct: 86 ASVSLFCPRAKPGEKKFRKVITKAPLEC 113 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/48 (29%), Positives = 18/48 (37%) Frame = +1 Query: 172 IISPMASCNAFCTCGISSSERFRPNLKKYPLSCQSYRRIPDGDNTFPP 315 I M + F + + +R PNL Y LS R D PP Sbjct: 99 IFMGMRTYEDFLSVAVYCRDRLNPNLFIYALSVAILHRPDTKDLPVPP 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,872 Number of Sequences: 438 Number of extensions: 6065 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -