BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0739.Seq (690 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q87NC2 Cluster: DNA polymerase; n=2; Vibrio|Rep: DNA po... 33 6.6 UniRef50_Q9G8N5 Cluster: Ribosomal protein S4; n=1; Naegleria gr... 33 6.6 >UniRef50_Q87NC2 Cluster: DNA polymerase; n=2; Vibrio|Rep: DNA polymerase - Vibrio parahaemolyticus Length = 787 Score = 33.1 bits (72), Expect = 6.6 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -2 Query: 137 LTRERRDLNENTRFGVANATYLNPWDILIDKIKPVFFL 24 LTR+ RD+ T+ + AT P +LI+ KPVFF+ Sbjct: 9 LTRQARDIKGQTQIELWLATEAGPTQLLINGEKPVFFI 46 >UniRef50_Q9G8N5 Cluster: Ribosomal protein S4; n=1; Naegleria gruberi|Rep: Ribosomal protein S4 - Naegleria gruberi Length = 482 Score = 33.1 bits (72), Expect = 6.6 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 476 RFAAIFKKKCNEIIFYFYIFKLIREAKTLF 565 RF + KKK N+ F+FY+ ++ R+ K LF Sbjct: 132 RFFILIKKKLNKKFFFFYLVQMFRKIKFLF 161 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,658,493 Number of Sequences: 1657284 Number of extensions: 13838991 Number of successful extensions: 24870 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24866 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -