BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0739.Seq (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0026 - 189876-190073,190473-190559,190654-190877,190961-19... 29 2.6 >08_01_0026 - 189876-190073,190473-190559,190654-190877,190961-191261, 191369-191467,193465-193602,193691-193879 Length = 411 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 322 TIRAKPKSGIQ*F-LSTYDFHSKIIKCDKFHGK 227 TI A+ K+G++ L TYDF++ + C F GK Sbjct: 103 TITAQLKNGVRGLMLDTYDFNNDVWLCHSFQGK 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,855,722 Number of Sequences: 37544 Number of extensions: 354223 Number of successful extensions: 565 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -