BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0738.Seq (823 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 94 1e-19 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 93.9 bits (223), Expect = 1e-19 Identities = 42/75 (56%), Positives = 52/75 (69%) Frame = +2 Query: 2 LKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGPLIIFNKDQGLTRAFRNIPGVEXXXXX 181 + A+ D+ K S+++RAGKGKMRNRR + RKGPLII+N DQGL +AFRN+PGVE Sbjct: 171 VNAYEDVEKCIDSKKIRAGKGKMRNRRTVMRKGPLIIYNNDQGLRQAFRNLPGVELQHVD 230 Query: 182 XXXXXXXAPGGHLGR 226 PGGHLGR Sbjct: 231 RLNLLKLCPGGHLGR 245 Score = 37.9 bits (84), Expect = 0.010 Identities = 27/64 (42%), Positives = 33/64 (51%) Frame = +1 Query: 313 NLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKR 492 NLP ++ + D LLK + R P R RA K NPL N ML+LNPYA KR Sbjct: 220 NLPGVELQHVDRLNLLKLCPGGHLGR-PKAR--RAIHKKNPLKNLGTMLRLNPYAKSAKR 276 Query: 493 KAIL 504 +L Sbjct: 277 AEML 280 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = +1 Query: 286 TPSKQKKNFNLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLN 432 TP++Q F + +++N D++RL S+ + ++ N RVI+++ N Sbjct: 802 TPTEQDAEFTANEAEVSNQDISRLSSSEPSPIIPKSINNRVIKSSALSN 850 >SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +3 Query: 297 TKEELQPAPTEDGQH*PHTSSQV**DQEGPPCSQQTRDPCYTQIE--PAH*QQGDAETQS 470 ++++ P P++ +H P S Q Q P SQQ R P +Q + P H QQ ETQS Sbjct: 206 SQQQRHPRPSQQQRH-PRPSQQ----QRYPRPSQQQRQPRPSQQQRYPRHNQQQTPETQS 260 Query: 471 LRGRAEEES 497 E +S Sbjct: 261 TTEIPETQS 269 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +1 Query: 361 KSDEIRKVLRAPNKRV---IRATRKLNPLTNNKAMLKL 465 +SD I K+ NK++ ++ L+ LTNNKA LKL Sbjct: 27 QSDVIHKIPNEANKQIGLRVKCLALLDYLTNNKAQLKL 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,039,851 Number of Sequences: 59808 Number of extensions: 345834 Number of successful extensions: 1214 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1193 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -