BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0737.Seq (829 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 45 3e-06 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 26 1.6 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 24 5.0 AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding pr... 23 8.7 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 8.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.7 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 8.7 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 44.8 bits (101), Expect = 3e-06 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = -2 Query: 216 LKKPLRVEFIGEEAEDAGGVKKEFFMLLLKEIFDPVYGMFKQSEE 82 ++K L V+F GEE D GGV +E+ LL E+ +P YG+F+ S + Sbjct: 516 MRKRLMVKFKGEEGLDYGGVAREWLYLLSHEMLNPQYGLFQYSRD 560 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 681 TVLSGADGPLRETIHPNQVFG 743 T L GAD PLR+ P + FG Sbjct: 350 TALKGADAPLRKVGDPTKRFG 370 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 152 KNSSCYCSRKYLIPYTVCSSNPRRRT 75 +N+ C C + PY VC N +T Sbjct: 18 QNAHCACPYAHPYPYDVCGPNEEFQT 43 >AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding protein AgamOBP49 protein. Length = 179 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 684 RFFALLTLEVHVSLIVDSCSKLEQHS 607 R F LLTL + + D C ++ HS Sbjct: 10 RSFLLLTLHLLPQSVADDCIDMDLHS 35 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 684 RFFALLTLEVHVSLIVDSCSKLEQHS 607 R F LLTL + + D C ++ HS Sbjct: 10 RSFLLLTLHLLPQSVADDCIDMDLHS 35 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 359 NPGVTQLNRLAAHPPFASWRNS 424 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 8.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 183 EEAEDAGGVKKEFFMLLLKEIFD 115 E AEDA KK+ +L ++EI D Sbjct: 21 ESAEDAEAAKKDAELLAVQEIRD 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 879,125 Number of Sequences: 2352 Number of extensions: 19868 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -