Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0736.Seq
         (347 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g10780.1 68416.m01298 emp24/gp25L/p24 family protein similar ...    27   4.5  

>At3g10780.1 68416.m01298 emp24/gp25L/p24 family protein similar to
           SP|O35587 Transmembrane protein Tmp21 precursor (21 kDa
           Transmembrane trafficking protein) {Mesocricetus
           auratus}; contains Pfam profile: PF01105 emp24/gp25L/p24
           family; contains non-consensus TG acceptor splice site
           at exon 3
          Length = 217

 Score = 26.6 bits (56), Expect = 4.5
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -2

Query: 166 VRSSIRYIMSAVRFNIVATNARESVRNRINDKN*ERSN 53
           +R S  Y  SA+R NI+    RE+    IN+K   R N
Sbjct: 150 IRRSTEYA-SAIRANILYLRIREAYMREINEKTNTRVN 186


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,585,272
Number of Sequences: 28952
Number of extensions: 57850
Number of successful extensions: 162
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 162
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 429398688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)