BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0733.Seq (717 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122228-1|AAM52740.1| 935|Drosophila melanogaster RE27507p pro... 30 3.6 AE014134-1118|AAF52407.3| 935|Drosophila melanogaster CG11319-P... 30 3.6 >AY122228-1|AAM52740.1| 935|Drosophila melanogaster RE27507p protein. Length = 935 Score = 29.9 bits (64), Expect = 3.6 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = +1 Query: 457 TKIIIFYNTNKLYRSVVMLVKYCLFSCRDA-RMTHDGRNYFDAF*KPLFTLTA----AFS 621 +KI + + SVV + K LF C + R++ DGR + D PLF A A S Sbjct: 358 SKIAVVWLNRPQNISVVSVCKAPLFQCIETHRVSGDGRGWVDTVAVPLFAANASIYVAIS 417 Query: 622 PL 627 PL Sbjct: 418 PL 419 >AE014134-1118|AAF52407.3| 935|Drosophila melanogaster CG11319-PA protein. Length = 935 Score = 29.9 bits (64), Expect = 3.6 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = +1 Query: 457 TKIIIFYNTNKLYRSVVMLVKYCLFSCRDA-RMTHDGRNYFDAF*KPLFTLTA----AFS 621 +KI + + SVV + K LF C + R++ DGR + D PLF A A S Sbjct: 358 SKIAVVWLNRPQNISVVSVCKAPLFQCIETHRVSGDGRGWVDTVAVPLFAANASIYVAIS 417 Query: 622 PL 627 PL Sbjct: 418 PL 419 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,495,104 Number of Sequences: 53049 Number of extensions: 392882 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -