BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0733.Seq (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.13 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 27 0.18 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 27 0.18 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 25 0.94 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 25 0.94 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 25 0.94 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 25 0.94 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.94 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.94 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.94 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.94 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 1.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.9 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 3.8 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 3.8 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 3.8 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 3.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 3.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 3.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 6.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 6.7 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 2 NNRY*MPNFK*LVVSYTYIHNYNNSYKQLFKLCSYTFN 115 +N Y N+ +Y +NYNN+Y +K Y N Sbjct: 319 SNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNIN 356 Score = 25.4 bits (53), Expect = 0.54 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 53 YIHNYNNSYKQLFKLCSY 106 Y +NYNN+YK+L+ +Y Sbjct: 340 YNNNYNNNYKKLYYNINY 357 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +2 Query: 2 NNRY*MPNFK*LVVSYT--YIHNYNNSYKQLFK 94 +N Y N+ +Y Y +NYNN+YK+L+K Sbjct: 86 SNNYKYSNYNNYNNNYNNNYNNNYNNNYKKLYK 118 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +2 Query: 2 NNRY*MPNFK*LVVSYT--YIHNYNNSYKQLFK 94 +N Y N+ +Y Y +NYNN+YK+L+K Sbjct: 86 SNNYKYSNYNNYNNNYNNNYNNNYNNNYKKLYK 118 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 88 NYNY-NNYNNNYKPLYYNINY 107 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 88 NYNY-NNYNNNYKPLYYNINY 107 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 88 NYNY-NNYNNNYKPLYYNINY 107 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 88 NYNY-NNYNNNYKPLYYNINY 107 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 321 NYNY-NNYNNNYKPLYYNINY 340 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 321 NYNY-NNYNNNYKPLYYNINY 340 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 321 NYNY-NNYNNNYKPLYYNINY 340 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 0.94 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L+ +Y Sbjct: 310 NYNY-NNYNNNYKPLYYNINY 329 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y+ +NYNN+Y K Y N Sbjct: 90 NYSNYNNYNNNYNNYNKKLYYNIN 113 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLF 91 +Y Y +NYNN+YK L+ Sbjct: 321 NYNY-NNYNNNYKPLY 335 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 671 QLDQNYGISLNCAQTSGENAA 609 ++ NYGIS +T+G+ AA Sbjct: 379 EMRDNYGISAGLNRTAGQQAA 399 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 47 YTYIHNYNNSYKQLFKLCSY 106 Y+ +NYNN+Y +K Y Sbjct: 91 YSNYNNYNNNYNTNYKKLQY 110 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 2 NNRY*MPNFK*LVVSYTYIHNYNNSYKQLFKLCSY 106 NN Y N+ +Y Y +N N+YK+L+ +Y Sbjct: 93 NNNYNNNNYN----NYNYNNNNYNNYKKLYYNINY 123 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 91 NYNYNNNYNNYNKHNYNKLYYNIN 114 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSY 106 +Y Y +NYNN+YK L +Y Sbjct: 321 NYNY-NNYNNNYKPLHYNINY 340 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 324 NYNYNNNYNNYNKHNYNKLYYNIN 347 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 44 SYTYIHNYNNSYKQLFKLCSYTFN 115 +Y Y +NYNN K + Y N Sbjct: 324 NYNYNNNYNNYNKHNYNKLYYNIN 347 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 56 IHNYNNSYKQL 88 IHN NN+YK+L Sbjct: 90 IHNNNNNYKKL 100 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 56 IHNYNNSYKQL 88 IHN NN+YK+L Sbjct: 90 IHNNNNNYKKL 100 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 56 IHNYNNSYKQL 88 IHN NN+YK+L Sbjct: 90 IHNNNNNYKKL 100 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 56 IHNYNNSYKQL 88 IHN NN+YK+L Sbjct: 90 IHNNNNNYKKL 100 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 324 KQALIKCKIIVIQLIKFYVDNLITYLKNEVTVTENRKM**SFN 196 KQ ++KC I + + + N + L + V + RK+ +FN Sbjct: 661 KQVILKCNIQDMSFLFSQLYNALLILISTVYAVKTRKIPENFN 703 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 56 IHNYNNSYKQL 88 IHN NN+YK+L Sbjct: 323 IHNNNNNYKKL 333 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 324 KQALIKCKIIVIQLIKFYVDNLITYLKNEVTVTENRKM**SFN 196 KQ ++KC I + + + N + L + V + RK+ +FN Sbjct: 751 KQVILKCNIQDMSFLFSQLYNALLILISTVYAVKTRKIPENFN 793 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 53 YIHNYNNSYKQLFKLCSY 106 Y +NYNN+ K+L+ +Y Sbjct: 96 YKYNYNNNCKKLYYNINY 113 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 44 SYTYIHNYNNSYKQL 88 +Y Y + NN+YKQL Sbjct: 88 NYNYSNYNNNNYKQL 102 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 464 LLFFIILTSYIVLLL 508 L FFI++ +YI++L+ Sbjct: 411 LSFFIVIFTYIIILI 425 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,014 Number of Sequences: 438 Number of extensions: 3287 Number of successful extensions: 63 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -