BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0728.Seq (489 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0279 + 20318440-20318688,20318785-20318931,20319449-203196... 27 8.1 >01_05_0279 + 20318440-20318688,20318785-20318931,20319449-20319611, 20319770-20319887,20320607-20320676,20320774-20320854, 20320924-20320959,20321129-20321149,20321586-20321642, 20321716-20321827,20321905-20322178,20322454-20322556, 20323244-20323459,20324615-20324665,20325339-20327963 Length = 1440 Score = 27.1 bits (57), Expect = 8.1 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 343 LRFEISNIII-FMYKMRNARA-HTAKTSKRRVHVQTSRRVA 459 L FEI + + F YK+ + TAK KR HV+ RR+A Sbjct: 615 LAFEIEDAVDEFTYKLEDKHGGFTAKMKKRIKHVKAWRRLA 655 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,754,521 Number of Sequences: 37544 Number of extensions: 137949 Number of successful extensions: 315 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -