BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0717.Seq (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.90 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 25 0.90 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.4 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 24.6 bits (51), Expect = 0.90 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = +1 Query: 217 DYKDPEITPSKLLE*SELNQANIFHTGKKGYWMN*KFMRRPESLWLKIY 363 +Y DPE +E ELN + YWM+ P+ + ++Y Sbjct: 213 EYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQYHMPKEIRGQLY 261 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 24.6 bits (51), Expect = 0.90 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = +1 Query: 217 DYKDPEITPSKLLE*SELNQANIFHTGKKGYWMN*KFMRRPESLWLKIY 363 +Y DPE +E ELN + YWM+ P+ + ++Y Sbjct: 213 EYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQYHMPKEIRGQLY 261 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 542 ILLGPGSGRIPVQFFCNQAL 483 IL+GPG+G P + F + L Sbjct: 969 ILVGPGTGIAPFRGFWHHRL 988 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,867 Number of Sequences: 438 Number of extensions: 4907 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -