BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0714.Seq (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0232 + 42182942-42183490,42183593-42183661,42184320-421844... 29 2.8 03_05_1150 - 30758981-30759778,30759970-30760729,30760823-307609... 28 8.5 >01_07_0232 + 42182942-42183490,42183593-42183661,42184320-42184451, 42184547-42184600,42184714-42184758,42185383-42185522, 42185777-42185902,42185985-42186002,42186631-42187276, 42188121-42188843 Length = 833 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 203 ANWVPAPPI-LNRRFLERRLTDDISANVSVSRGCGAPTA 90 ++W P PP+ L+ +FL R +A S+ CG P A Sbjct: 409 SSWPPPPPVQLSMQFLPPRPEPAAAARTSICCTCGVPMA 447 >03_05_1150 - 30758981-30759778,30759970-30760729,30760823-30760920, 30761997-30762521 Length = 726 Score = 27.9 bits (59), Expect = 8.5 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -2 Query: 194 VPAPP-ILNRRFLERRLTDDISANVSVSRGCGAPTARRTNATTSFLTATILVYAIGAELX 18 +P P +L+R F E++ I+ V G P A TN + +T TI Y + Sbjct: 602 LPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIASWLVTGTIFNYFVFKYRK 661 Query: 17 GCWHQ 3 G W + Sbjct: 662 GWWQK 666 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,868,155 Number of Sequences: 37544 Number of extensions: 305583 Number of successful extensions: 525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -