BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0714.Seq (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 82 4e-16 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 62 6e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 62 6e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 62 6e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 62 6e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 62 6e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 62 6e-10 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 62 6e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 62 6e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 62 6e-10 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 62 6e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 62 6e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 62 6e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 62 6e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 62 6e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 62 6e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 62 6e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 62 6e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 62 6e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 62 6e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 62 6e-10 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 62 6e-10 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 62 6e-10 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 62 6e-10 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 62 6e-10 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 62 6e-10 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 62 6e-10 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 62 6e-10 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 62 6e-10 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 62 6e-10 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 62 6e-10 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 62 6e-10 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 62 6e-10 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 62 6e-10 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 62 6e-10 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 62 6e-10 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 62 6e-10 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 62 6e-10 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 62 6e-10 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 62 6e-10 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 62 6e-10 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 62 6e-10 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 62 6e-10 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 62 6e-10 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 62 6e-10 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 62 6e-10 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 62 6e-10 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 62 6e-10 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 62 6e-10 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 62 6e-10 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 62 6e-10 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 62 6e-10 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 62 6e-10 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 62 6e-10 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 62 6e-10 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 62 6e-10 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 62 6e-10 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 62 6e-10 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 62 6e-10 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 62 6e-10 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 62 6e-10 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 62 6e-10 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 62 6e-10 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 62 6e-10 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 62 6e-10 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 62 6e-10 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 62 6e-10 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 62 6e-10 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 62 6e-10 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 62 6e-10 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 62 6e-10 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 62 6e-10 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 62 6e-10 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 62 6e-10 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 62 6e-10 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 82.2 bits (194), Expect = 4e-16 Identities = 38/54 (70%), Positives = 39/54 (72%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEAPHRSPFPTVAXLXWANGXL 394 GR WENPGVTQLNRLAA PPFASWRNSE PHRSPFPTVA W G + Sbjct: 345 GRHLQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPEWRMGLM 397 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 68.5 bits (160), Expect = 5e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 379 PXQXRNCWEGRSVRXLFAITPAGERGXCCKAIKL 278 P + RNCWEGRSVR LFAITPAGERG CCKAIKL Sbjct: 45 PFRLRNCWEGRSVRGLFAITPAGERGMCCKAIKL 78 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR FT WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 41 GRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 67.7 bits (158), Expect = 9e-12 Identities = 36/63 (57%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 380 PXPXAQLLGRAIGAXPLRYYASWRKGDXLQGD*-VE*XQGFPSTTL*NXGPVNCNTTHYR 204 P AQLLGRAIGA + KGD LQGD + QGFPS + PVNCNTTHYR Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYR 99 Query: 203 ANW 195 ANW Sbjct: 100 ANW 102 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 5e-11 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +3 Query: 168 PVQYRXGRYP--IRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXR 341 PV+Y G + +RP+VSRITIHW TGKT SPAGVIA+ R Sbjct: 21 PVKYIPGIFQGNLRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEAR 80 Query: 342 TDRPSQQLRXWXG 380 TDRPSQQLR G Sbjct: 81 TDRPSQQLRSLNG 93 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 16 GRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 50 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 36 GRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 26 GRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 60 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 46 GRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +2 Query: 233 GRXFTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 GR WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 73 GRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 107 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 FTTSYWENPGVTQLNRLAAXPPFASWRNSEEA 337 + +WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 12 YNVVHWENPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.5 bits (145), Expect = 3e-10 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEAPHRSPFPTVAXL 373 WENPGVTQLNRLAA PPFASWRNSEEA P V L Sbjct: 17 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQVRSL 55 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 44 WENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 71 WENPGVTQLNRLAAHPPFASWRNSEEA 97 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Query: 375 XG 380 G Sbjct: 110 NG 111 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 53 WENPGVTQLNRLAAHPPFASWRNSEEA 79 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 45 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 93 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 71 WENPGVTQLNRLAAHPPFASWRNSEEA 97 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 63 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 111 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 76 WENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 116 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 47 WENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 87 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 67 WENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 107 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 79 WENPGVTQLNRLAAHPPFASWRNSEEA 105 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 71 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 119 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 55 WENPGVTQLNRLAAHPPFASWRNSEEA 81 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 95 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 44 WENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 34 WENPGVTQLNRLAAHPPFASWRNSEEA 60 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 72 Query: 375 XG 380 G Sbjct: 73 NG 74 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 59 WENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 99 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 68 WENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 60 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 108 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 62 WENPGVTQLNRLAAHPPFASWRNSEEA 88 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 54 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 102 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 78 WENPGVTQLNRLAAHPPFASWRNSEEA 104 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 70 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 118 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 106 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 49 WENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 89 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 225 WENPGVTQLNRLAAHPPFASWRNSEEA 251 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 217 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 265 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 120 WENPGVTQLNRLAAHPPFASWRNSEEA 146 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 160 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 58 WENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Query: 375 XG 380 G Sbjct: 97 NG 98 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 37 WENPGVTQLNRLAAHPPFASWRNSEEA 63 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Query: 375 XG 380 G Sbjct: 76 NG 77 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 25 WENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 375 XG 380 G Sbjct: 64 NG 65 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 56 WENPGVTQLNRLAAHPPFASWRNSEEA 82 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 48 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 96 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 390 WENPGVTQLNRLAAHPPFASWRNSEEA 416 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 382 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 430 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Query: 375 XG 380 G Sbjct: 77 NG 78 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 116 WENPGVTQLNRLAAHPPFASWRNSEEA 142 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 108 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 156 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 92 WENPGVTQLNRLAAHPPFASWRNSEEA 118 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 84 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 132 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 48 WENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 88 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 17 WENPGVTQLNRLAAHPPFASWRNSEEA 43 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 9 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 27 WENPGVTQLNRLAAHPPFASWRNSEEA 53 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Query: 375 XG 380 G Sbjct: 66 NG 67 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 47 WENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 87 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 112 WENPGVTQLNRLAAHPPFASWRNSEEA 138 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 104 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 152 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 54 WENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 94 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 349 WENPGVTQLNRLAAHPPFASWRNSEEA 375 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 389 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 89 WENPGVTQLNRLAAHPPFASWRNSEEA 115 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 81 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 129 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 59 WENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 99 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 25 WENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 375 XG 380 G Sbjct: 64 NG 65 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 68 WENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 60 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 108 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 143 WENPGVTQLNRLAAHPPFASWRNSEEA 169 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 183 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 72 WENPGVTQLNRLAAHPPFASWRNSEEA 98 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 64 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 112 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 48 WENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 88 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 152 WENPGVTQLNRLAAHPPFASWRNSEEA 178 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 144 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 192 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 842 WENPGVTQLNRLAAHPPFASWRNSEEA 868 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 880 Query: 375 XG 380 G Sbjct: 881 NG 882 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 25 WENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 375 XG 380 G Sbjct: 64 NG 65 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 69 WENPGVTQLNRLAAHPPFASWRNSEEA 95 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 61 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 109 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 43 WENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 83 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 82 WENPGVTQLNRLAAHPPFASWRNSEEA 108 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 74 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 122 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 65 WENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 105 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 78 WENPGVTQLNRLAAHPPFASWRNSEEA 104 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 70 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 118 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 74 WENPGVTQLNRLAAHPPFASWRNSEEA 100 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 265 WENPGVTQLNRLAAHPPFASWRNSEEA 291 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 257 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 305 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 123 WENPGVTQLNRLAAHPPFASWRNSEEA 149 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 161 Query: 375 XG 380 G Sbjct: 162 NG 163 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 59 WENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 99 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 46 WENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 86 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 110 WENPGVTQLNRLAAHPPFASWRNSEEA 136 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 102 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 150 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 123 WENPGVTQLNRLAAHPPFASWRNSEEA 149 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 115 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 163 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 48 WENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Query: 375 XG 380 G Sbjct: 87 NG 88 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 29 WENPGVTQLNRLAAHPPFASWRNSEEA 55 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 375 XG 380 G Sbjct: 68 NG 69 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 67 WENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 107 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 46 WENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 375 XG 380 G Sbjct: 85 NG 86 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 43 WENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 83 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 20 WENPGVTQLNRLAAHPPFASWRNSEEA 46 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 12 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 60 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 28 WENPGVTQLNRLAAHPPFASWRNSEEA 54 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 66 Query: 375 XG 380 G Sbjct: 67 NG 68 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 405 WENPGVTQLNRLAAHPPFASWRNSEEA 431 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 397 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 445 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 54 WENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 94 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 63 WENPGVTQLNRLAAHPPFASWRNSEEA 89 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 103 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 128 WENPGVTQLNRLAAHPPFASWRNSEEA 154 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 120 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 168 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 64 WENPGVTQLNRLAAHPPFASWRNSEEA 90 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 56 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 104 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 74 WENPGVTQLNRLAAHPPFASWRNSEEA 100 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 114 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 77 WENPGVTQLNRLAAHPPFASWRNSEEA 103 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 69 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 117 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 423 WENPGVTQLNRLAAHPPFASWRNSEEA 449 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 415 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 463 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 120 WENPGVTQLNRLAAHPPFASWRNSEEA 146 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 160 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 76 WENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 116 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 65 WENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 105 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 55 WENPGVTQLNRLAAHPPFASWRNSEEA 81 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 95 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 170 WENPGVTQLNRLAAHPPFASWRNSEEA 196 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 162 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 210 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 74 WENPGVTQLNRLAAHPPFASWRNSEEA 100 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 114 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 61 WENPGVTQLNRLAAHPPFASWRNSEEA 87 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 53 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 101 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 97 WENPGVTQLNRLAAHPPFASWRNSEEA 123 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 135 Query: 375 XG 380 G Sbjct: 136 NG 137 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 46 WENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 375 XG 380 G Sbjct: 85 NG 86 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 72 WENPGVTQLNRLAAHPPFASWRNSEEA 98 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 64 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 112 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 51 WENPGVTQLNRLAAHPPFASWRNSEEA 77 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 43 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 91 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 194 WENPGVTQLNRLAAHPPFASWRNSEEA 220 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 186 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 234 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 43 WENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 83 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 49 WENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 89 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 63 WENPGVTQLNRLAAHPPFASWRNSEEA 89 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 103 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 60 WENPGVTQLNRLAAHPPFASWRNSEEA 86 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 52 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 100 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 43 WENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 83 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 44 WENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 58 WENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 98 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 48 WENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 88 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 141 WENPGVTQLNRLAAHPPFASWRNSEEA 167 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 179 Query: 375 XG 380 G Sbjct: 180 NG 181 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 50 WENPGVTQLNRLAAHPPFASWRNSEEA 76 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 42 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 90 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 93 WENPGVTQLNRLAAHPPFASWRNSEEA 119 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 85 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 133 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 31 WENPGVTQLNRLAAHPPFASWRNSEEA 57 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 375 XG 380 G Sbjct: 70 NG 71 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 162 WENPGVTQLNRLAAHPPFASWRNSEEA 188 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 200 Query: 375 XG 380 G Sbjct: 201 NG 202 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 349 WENPGVTQLNRLAAHPPFASWRNSEEA 375 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 389 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Query: 375 XG 380 G Sbjct: 105 NG 106 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 30 WENPGVTQLNRLAAHPPFASWRNSEEA 56 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Query: 375 XG 380 G Sbjct: 69 NG 70 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 56 WENPGVTQLNRLAAHPPFASWRNSEEA 82 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 118 WENPGVTQLNRLAAHPPFASWRNSEEA 144 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 110 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 158 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 95 WENPGVTQLNRLAAHPPFASWRNSEEA 121 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 87 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 135 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 69 WENPGVTQLNRLAAHPPFASWRNSEEA 95 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 107 Query: 375 XG 380 G Sbjct: 108 NG 109 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 303 WENPGVTQLNRLAAHPPFASWRNSEEA 329 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 295 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 343 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 106 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 67 WENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 107 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 25 WENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 375 XG 380 G Sbjct: 64 NG 65 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 420 WENPGVTQLNRLAAHPPFASWRNSEEA 446 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 412 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 460 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 104 WENPGVTQLNRLAAHPPFASWRNSEEA 130 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 96 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 144 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 60 WENPGVTQLNRLAAHPPFASWRNSEEA 86 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 52 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 100 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 102 WENPGVTQLNRLAAHPPFASWRNSEEA 128 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 94 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 142 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 220 WENPGVTQLNRLAAHPPFASWRNSEEA 246 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 212 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 260 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 222 WENPGVTQLNRLAAHPPFASWRNSEEA 248 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 214 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 262 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 42 WENPGVTQLNRLAAHPPFASWRNSEEA 68 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = +3 Query: 168 PVQYRXGRY--PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXR 341 PV R Y P+ ++ AVVLQRR + + ++ R Sbjct: 10 PVTPRIQSYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 69 Query: 342 TDRPSQQLRXWXG 380 TDRPSQQLR G Sbjct: 70 TDRPSQQLRSLNG 82 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 57 WENPGVTQLNRLAAHPPFASWRNSEEA 83 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 95 Query: 375 XG 380 G Sbjct: 96 NG 97 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 47 WENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 87 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 156 WENPGVTQLNRLAAHPPFASWRNSEEA 182 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 148 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 196 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 54 WENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 94 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 44 WENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 64 WENPGVTQLNRLAAHPPFASWRNSEEA 90 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 56 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 104 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 49 WENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Query: 375 XG 380 G Sbjct: 88 NG 89 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 84 WENPGVTQLNRLAAHPPFASWRNSEEA 110 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 122 Query: 375 XG 380 G Sbjct: 123 NG 124 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 204 WENPGVTQLNRLAAHPPFASWRNSEEA 230 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 196 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 244 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 62 WENPGVTQLNRLAAHPPFASWRNSEEA 88 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 54 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 102 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 41 WENPGVTQLNRLAAHPPFASWRNSEEA 67 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 33 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 81 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 95 WENPGVTQLNRLAAHPPFASWRNSEEA 121 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 87 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 135 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 31 WENPGVTQLNRLAAHPPFASWRNSEEA 57 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 375 XG 380 G Sbjct: 70 NG 71 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 58 WENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 98 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 196 WENPGVTQLNRLAAHPPFASWRNSEEA 222 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 188 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 236 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 106 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 76 WENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 116 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 59 WENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 99 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = +3 Query: 186 GRYPIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQL 365 G P+ ++ AVVLQRR + + ++ RTDRPSQQL Sbjct: 42 GGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 101 Query: 366 RXWXG 380 R G Sbjct: 102 RSLNG 106 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 109 WENPGVTQLNRLAAHPPFASWRNSEEA 135 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/69 (28%), Positives = 28/69 (40%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 147 Query: 375 XGRMAXCKR 401 G +R Sbjct: 148 NGEWRLMRR 156 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 85 WENPGVTQLNRLAAHPPFASWRNSEEA 111 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 77 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 125 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 105 WENPGVTQLNRLAAHPPFASWRNSEEA 131 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 97 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 145 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 82 WENPGVTQLNRLAAHPPFASWRNSEEA 108 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 375 XG 380 G Sbjct: 121 NG 122 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 49 WENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 89 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 58 WENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 98 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 672 WENPGVTQLNRLAAHPPFASWRNSEEA 698 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 664 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 712 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 57 WENPGVTQLNRLAAHPPFASWRNSEEA 83 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 49 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 97 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 46 WENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 86 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 37 WENPGVTQLNRLAAHPPFASWRNSEEA 63 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Query: 375 XG 380 G Sbjct: 76 NG 77 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 155 WENPGVTQLNRLAAHPPFASWRNSEEA 181 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 193 Query: 375 XG 380 G Sbjct: 194 NG 195 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 47 WENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 87 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 68 WENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 106 Query: 375 XG 380 G Sbjct: 107 NG 108 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 97 WENPGVTQLNRLAAHPPFASWRNSEEA 123 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 135 Query: 375 XG 380 G Sbjct: 136 NG 137 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 109 WENPGVTQLNRLAAHPPFASWRNSEEA 135 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = +3 Query: 186 GRYPIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQL 365 G P+ ++ AVVLQRR + + ++ RTDRPSQQL Sbjct: 85 GGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 144 Query: 366 RXWXG 380 R G Sbjct: 145 RSLNG 149 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 52 WENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 92 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 1199 WENPGVTQLNRLAAHPPFASWRNSEEA 1225 Score = 37.1 bits (82), Expect = 0.014 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -1 Query: 399 AYNXPFAHXXCATVGKGDRCGASSLLRQLAKGGXAARRLS 280 A + PF C +G ASSLLRQLAKGG AARRLS Sbjct: 402 ASHSPFRLRNC---WEGRSVRASSLLRQLAKGGCAARRLS 438 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 1237 Query: 375 XG 380 G Sbjct: 1238 NG 1239 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 51 WENPGVTQLNRLAAHPPFASWRNSEEA 77 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 43 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 91 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 41 WENPGVTQLNRLAAHPPFASWRNSEEA 67 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 79 Query: 375 XG 380 G Sbjct: 80 NG 81 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 134 WENPGVTQLNRLAAHPPFASWRNSEEA 160 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 172 Query: 375 XG 380 G Sbjct: 173 NG 174 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 65 WENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 105 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 86 WENPGVTQLNRLAAHPPFASWRNSEEA 112 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 124 Query: 375 XG 380 G Sbjct: 125 NG 126 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 59 WENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 99 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 135 WENPGVTQLNRLAAHPPFASWRNSEEA 161 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 175 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 177 WENPGVTQLNRLAAHPPFASWRNSEEA 203 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 169 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 217 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 40 WENPGVTQLNRLAAHPPFASWRNSEEA 66 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 78 Query: 375 XG 380 G Sbjct: 79 NG 80 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 89 WENPGVTQLNRLAAHPPFASWRNSEEA 115 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 81 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 129 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 39 WENPGVTQLNRLAAHPPFASWRNSEEA 65 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 31 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNG 79 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 54 WENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 94 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 25 WENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 375 XG 380 G Sbjct: 64 NG 65 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 84 WENPGVTQLNRLAAHPPFASWRNSEEA 110 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 124 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 934 WENPGVTQLNRLAAHPPFASWRNSEEA 960 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 926 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 974 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 43 WENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Query: 375 XG 380 G Sbjct: 82 NG 83 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Query: 375 XG 380 G Sbjct: 84 NG 85 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 55 WENPGVTQLNRLAAHPPFASWRNSEEA 81 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 95 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 45 WENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 105 WENPGVTQLNRLAAHPPFASWRNSEEA 131 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 143 Query: 375 XG 380 G Sbjct: 144 NG 145 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 362 WENPGVTQLNRLAAHPPFASWRNSEEA 388 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 354 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 402 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 92 WENPGVTQLNRLAAHPPFASWRNSEEA 118 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 84 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 132 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 74 WENPGVTQLNRLAAHPPFASWRNSEEA 100 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 114 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 84 WENPGVTQLNRLAAHPPFASWRNSEEA 110 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 124 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 17 WENPGVTQLNRLAAHPPFASWRNSEEA 43 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 9 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 57 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 70 WENPGVTQLNRLAAHPPFASWRNSEEA 96 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 108 Query: 375 XG 380 G Sbjct: 109 NG 110 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 93 WENPGVTQLNRLAAHPPFASWRNSEEA 119 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 131 Query: 375 XG 380 G Sbjct: 132 NG 133 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 38 WENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 49 WENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Query: 375 XG 380 G Sbjct: 88 NG 89 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 135 WENPGVTQLNRLAAHPPFASWRNSEEA 161 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 175 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 93 WENPGVTQLNRLAAHPPFASWRNSEEA 119 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 131 Query: 375 XG 380 G Sbjct: 132 NG 133 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 1482 WENPGVTQLNRLAAHPPFASWRNSEEA 1508 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 1474 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 1522 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 106 WENPGVTQLNRLAAHPPFASWRNSEEA 132 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 98 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 146 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 66 WENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 106 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 63 WENPGVTQLNRLAAHPPFASWRNSEEA 89 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 103 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 113 WENPGVTQLNRLAAHPPFASWRNSEEA 139 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 105 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 153 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 56 WENPGVTQLNRLAAHPPFASWRNSEEA 82 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 48 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 96 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 93 WENPGVTQLNRLAAHPPFASWRNSEEA 119 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 131 Query: 375 XG 380 G Sbjct: 132 NG 133 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 917 WENPGVTQLNRLAAHPPFASWRNSEEA 943 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 234 AVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXWXG 380 AVVLQRR + + ++ RTDRPSQQLR G Sbjct: 909 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 957 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 257 WENPGVTQLNRLAAXPPFASWRNSEEA 337 WENPGVTQLNRLAA PPFASWRNSEEA Sbjct: 30 WENPGVTQLNRLAAHPPFASWRNSEEA 56 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +3 Query: 195 PIRPIVSRITIHWAVVLQRRTGKTXXXXXXXXXXXXXXSPAGVIAKRXRTDRPSQQLRXW 374 P+ ++ AVVLQRR + + ++ RTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Query: 375 XG 380 G Sbjct: 69 NG 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,901,275 Number of Sequences: 59808 Number of extensions: 355063 Number of successful extensions: 8554 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8443 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -