BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0714.Seq (714 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z81546-3|CAB04451.1| 321|Caenorhabditis elegans Hypothetical pr... 28 7.6 >U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical protein C52E12.4 protein. Length = 1487 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 174 EPAFFRTPAHRRYLRK 127 EP+F RTPAH YL K Sbjct: 1451 EPSFLRTPAHMTYLAK 1466 >Z81546-3|CAB04451.1| 321|Caenorhabditis elegans Hypothetical protein F53A2.3 protein. Length = 321 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = -2 Query: 218 TTHYRANWVPAPPILNRRFLERRLTDDISANVSVSRGCGAPTARRTNATTSFLTA 54 TT +A+ VPA + + + R LTDD A+++V++ G TA+ ++ + A Sbjct: 172 TTGLKASLVPARFLKEKTVIVRNLTDD--ADINVNKVFGQLTAQSSSLKNIVINA 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,701,655 Number of Sequences: 27780 Number of extensions: 250381 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -